KEGG   Synechococcus lividus: BRW62_06650
Entry
BRW62_06650       CDS       T05303                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slw  Synechococcus lividus
Pathway
slw00010  Glycolysis / Gluconeogenesis
slw00020  Citrate cycle (TCA cycle)
slw00620  Pyruvate metabolism
slw01100  Metabolic pathways
slw01110  Biosynthesis of secondary metabolites
slw01120  Microbial metabolism in diverse environments
slw01200  Carbon metabolism
Module
slw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRW62_06650
   00020 Citrate cycle (TCA cycle)
    BRW62_06650
   00620 Pyruvate metabolism
    BRW62_06650
Enzymes [BR:slw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BRW62_06650
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase NAD_binding_5 MadL ATP-grasp
Other DBs
NCBI-ProteinID: ATS18486
UniProt: A0A2D2Q1X6
LinkDB
Position
complement(1361743..1362987)
AA seq 414 aa
MIRELFMPALSSTMTEGKIVSWLKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGETAPVGSTIGLVAETEAEIAEAKAKAHSATPASTPTAAAVSNGSPQTSSAPVAVAT
VPAARVVASPRARKLAKEHNIDLKTLKGTGPRGRITAADVEALIGTAPAPVVAPAVTSSP
MAAPTAPVVAKEDLVPLTTLQNAVVRNMVASLAIPDFHVAYTITTDALDRLYQQIKSKGV
TMTALLAKAIALTLQKHPIMNAYYTEQGIQYRQDINVAVAVAMPGGGLITPVLKNADQID
IYTLSRTWKDLVERARAKQLQPEEYNSGTFSLSNLGMFGVDSFDAILTPGQGAIMAVGAS
QPTVVATEEGLLGVKRQMKVNITCDHRVIYGADAAAFLRDLAKLIETNPQALTL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgattcgtgaactgtttatgcccgctttaagctccaccatgacagaaggcaaaattgtc
tcgtggctcaagtccccgggcgataaggtagccaagggcgaaacggtcttaattgttgaa
tctgacaaggctgatatggatgtggagtcgttctatgacggctacttggcggtgattaca
gtgcccgctggtgagaccgctcctgttggctccacaattggtttagtggcggaaacagaa
gcggaaattgcagaggcaaaagcgaaggcacactccgccactccggccagcactcccaca
gcagccgccgtgagtaatggcagcccgcagaccagttcagcccctgtagcggttgccact
gtccctgcggcgcgggttgtggcttccccccgtgcccgcaagttggcgaaagagcataac
attgatctgaaaaccctgaagggcacaggtcccagggggcggattaccgcagcagatgtg
gaagcactcatcggtacagcacctgcacccgttgttgcgcctgcggtgacctcatcgcct
atggctgctcccaccgcccctgtggtggccaaggaggatctggtgcccctgaccacactg
caaaatgcggtcgtgcggaatatggttgccagcttggcgattccagacttccatgtggct
tacaccattaccaccgatgccttggatcggctctaccagcagattaagtccaagggggtg
acgatgacagcactcttggccaaggcgatcgccctaacgctgcaaaagcaccccattatg
aatgcgtactataccgagcaagggattcaataccggcaggacattaacgtagcggtggcg
gtggccatgcccggtggcggtttgattactcctgtgctgaaaaatgccgatcagattgat
atttataccctttcgcgcacttggaaagaccttgtggagcgcgctcgggctaagcaactg
caacccgaggagtacaacagcggtaccttcagcctctctaacttagggatgtttggagtt
gatagttttgatgccattctcacgcctgggcaaggcgcaattatggcggtgggtgcctcg
caacccacggtcgtggccaccgaggagggtctgttgggggtgaagcggcaaatgaaggtg
aatatcacctgtgatcatcgggtgatttacggtgccgatgcagcggcctttctacgggat
ttagcaaagctaattgaaacaaacccccaagccttgaccctctaa

DBGET integrated database retrieval system