KEGG   Synechococcus lividus: BRW62_06650Help
Entry
BRW62_06650       CDS       T05303                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slw  Synechococcus lividus
Pathway
slw00010  Glycolysis / Gluconeogenesis
slw00020  Citrate cycle (TCA cycle)
slw00620  Pyruvate metabolism
slw01100  Metabolic pathways
slw01110  Biosynthesis of secondary metabolites
slw01120  Microbial metabolism in diverse environments
slw01130  Biosynthesis of antibiotics
slw01200  Carbon metabolism
Module
slw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRW62_06650
   00020 Citrate cycle (TCA cycle)
    BRW62_06650
   00620 Pyruvate metabolism
    BRW62_06650
Enzymes [BR:slw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BRW62_06650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase NAD_binding_5 MadL ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ATS18486
UniProt: A0A2D2Q1X6
LinkDB All DBs
Position
complement(1361743..1362987)
Genome map
AA seq 414 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWLKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGETAPVGSTIGLVAETEAEIAEAKAKAHSATPASTPTAAAVSNGSPQTSSAPVAVAT
VPAARVVASPRARKLAKEHNIDLKTLKGTGPRGRITAADVEALIGTAPAPVVAPAVTSSP
MAAPTAPVVAKEDLVPLTTLQNAVVRNMVASLAIPDFHVAYTITTDALDRLYQQIKSKGV
TMTALLAKAIALTLQKHPIMNAYYTEQGIQYRQDINVAVAVAMPGGGLITPVLKNADQID
IYTLSRTWKDLVERARAKQLQPEEYNSGTFSLSNLGMFGVDSFDAILTPGQGAIMAVGAS
QPTVVATEEGLLGVKRQMKVNITCDHRVIYGADAAAFLRDLAKLIETNPQALTL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgtttatgcccgctttaagctccaccatgacagaaggcaaaattgtc
tcgtggctcaagtccccgggcgataaggtagccaagggcgaaacggtcttaattgttgaa
tctgacaaggctgatatggatgtggagtcgttctatgacggctacttggcggtgattaca
gtgcccgctggtgagaccgctcctgttggctccacaattggtttagtggcggaaacagaa
gcggaaattgcagaggcaaaagcgaaggcacactccgccactccggccagcactcccaca
gcagccgccgtgagtaatggcagcccgcagaccagttcagcccctgtagcggttgccact
gtccctgcggcgcgggttgtggcttccccccgtgcccgcaagttggcgaaagagcataac
attgatctgaaaaccctgaagggcacaggtcccagggggcggattaccgcagcagatgtg
gaagcactcatcggtacagcacctgcacccgttgttgcgcctgcggtgacctcatcgcct
atggctgctcccaccgcccctgtggtggccaaggaggatctggtgcccctgaccacactg
caaaatgcggtcgtgcggaatatggttgccagcttggcgattccagacttccatgtggct
tacaccattaccaccgatgccttggatcggctctaccagcagattaagtccaagggggtg
acgatgacagcactcttggccaaggcgatcgccctaacgctgcaaaagcaccccattatg
aatgcgtactataccgagcaagggattcaataccggcaggacattaacgtagcggtggcg
gtggccatgcccggtggcggtttgattactcctgtgctgaaaaatgccgatcagattgat
atttataccctttcgcgcacttggaaagaccttgtggagcgcgctcgggctaagcaactg
caacccgaggagtacaacagcggtaccttcagcctctctaacttagggatgtttggagtt
gatagttttgatgccattctcacgcctgggcaaggcgcaattatggcggtgggtgcctcg
caacccacggtcgtggccaccgaggagggtctgttgggggtgaagcggcaaatgaaggtg
aatatcacctgtgatcatcgggtgatttacggtgccgatgcagcggcctttctacgggat
ttagcaaagctaattgaaacaaacccccaagccttgaccctctaa

DBGET integrated database retrieval system