KEGG   Synechococcus lividus: BRW62_07805Help
Entry
BRW62_07805       CDS       T05303                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
slw  Synechococcus lividus
Pathway
slw00630  Glyoxylate and dicarboxylate metabolism
slw00710  Carbon fixation in photosynthetic organisms
slw01100  Metabolic pathways
slw01120  Microbial metabolism in diverse environments
slw01200  Carbon metabolism
Module
slw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRW62_07805
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRW62_07805
Enzymes [BR:slw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRW62_07805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ATS18674
UniProt: A0A2D2Q2E8
LinkDB All DBs
Position
1603536..1603892
Genome map
AA seq 118 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYTIEQGYHPCVEFNESSDAEIRYWTMWKLPL
FNCTSPQEVLNEVQQCRSEYPNCYIRVVAFDNIKQCQVMSFIVHKPNQGNSGYSGYRY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacccaaagagcgtcgctacgaaaccttttcttacttgccgccgctgagt
gatgcccagattgcgcggcaaattcagtacaccattgagcaaggctaccacccctgcgtc
gagttcaacgaaagctctgatgctgaaatccgctactggaccatgtggaagttgcccctg
ttcaactgcaccagcccccaagaggtactcaacgaggtgcagcagtgccgctcggaatac
cccaactgctacattcgtgttgtggcttttgacaacattaagcagtgtcaggtgatgagc
tttatcgtccacaaacccaatcagggcaatagtggttatagcggctaccgttactaa

DBGET integrated database retrieval system