KEGG   Synechococcus lividus: BRW62_09115Help
Entry
BRW62_09115       CDS       T05303                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
slw  Synechococcus lividus
Brite
Enzymes [BR:slw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BRW62_09115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATS18877
UniProt: A0A2D2Q3N5
LinkDB All DBs
Position
complement(1905475..1906077)
Genome map
AA seq 200 aa AA seqDB search
MAFVQDPLPFDPGALEPYGMSAKTLEFHYGKHHKAYVDNLNKLTQDTELAEKSLEDVIRL
SYGDAAKAGIFNNAAQVWNHTFFWNSLKPGGGGTPTGDVAARINSAFGSFDEFKSQFKTA
AATQFGSGWAWLVLEAGTLKVTKTPNAENPLVHGQVPLLTLDVWEHAYYLDFQNRRPDFI
DNFLNQLVNWDFVAKNLAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaagaccccttaccctttgatcccggtgcccttgaaccctacggcatg
tcggccaaaacccttgagtttcactacggcaagcatcataaggcctacgttgataatttg
aacaaactcacccaagatacagagttggcagagaaatccttagaagatgtgattcggctc
agctatggcgatgcggctaaagccggaattttcaataatgcggctcaagtttggaaccat
acctttttctggaatagcctcaagcccggtgggggcggcaccccaactggcgatgtggct
gcccgtattaacagtgcctttggcagctttgacgagtttaagtctcagttcaaaaccgct
gccgccactcagtttgggagtggttgggcatggctcgtacttgaagcgggtacgctgaaa
gtcacgaaaacccctaatgccgaaaatccgctggttcacggtcaggtgcccttgctcacc
ctcgatgtctgggagcacgcctactacttggactttcaaaatcgccgccctgactttatc
gataacttcctcaatcaactggtgaactgggactttgttgccaaaaatcttgctgccgcc
tag

DBGET integrated database retrieval system