KEGG   Synechococcus lividus: BRW62_10370Help
Entry
BRW62_10370       CDS       T05303                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slw  Synechococcus lividus
Pathway
slw00473  D-Alanine metabolism
slw00550  Peptidoglycan biosynthesis
slw01100  Metabolic pathways
slw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRW62_10370
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRW62_10370
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BRW62_10370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slw01011]
    BRW62_10370
Enzymes [BR:slw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BRW62_10370
Peptidoglycan biosynthesis and degradation proteins [BR:slw01011]
 Precursor biosynthesis
  Amino acid ligase
   BRW62_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF2148
Motif
Other DBs
NCBI-ProteinID: ATS19075
UniProt: A0A2D2Q3K4
LinkDB All DBs
Position
complement(2197550..2198593)
Genome map
AA seq 347 aa AA seqDB search
MGRLRVGLLFGGRSREHEVSVVSAAAIAQAFADPLNGDRYEVVPIYIQKDGRWRCTETVS
APAPSLDNQSLWSFPAVAETIDVWFPILHGPNGEDGTIQGLLEMMQRPYVGSGVAASAIG
MDKILMKTFFGAVGLPQVQYVAISRSELWSDPCRYRQVCDRIETELGYPCFVKPANLGSS
VGISKAKNRQQLTTALETAAELDRRIIVEAGVVARELECAVLGNDAPQASVVGEITYSSE
FYDYETKYTDGRADLKIPADIPATVSNTIQDMALKAFTALDGAGLARFDFFYLPDNGQIL
INEVNTLPGFTALSMYPQLWAASGLSFPELVHRLVQLALERHRGIAW
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtctgcgggttgggttactatttggcggtcgctcgcgggagcacgaggtctcg
gttgtatcggcggcggcaattgcccaagcctttgccgatcctctcaatggcgatcgctat
gaggtggtgcccatttatattcaaaaagatggtcgttggcggtgtaccgaaaccgtcagt
gcgccagcaccttctctagataatcaatcgctgtggtcatttccggcagtggcagaaacc
attgatgtttggttccccattctccacggccccaacggtgaagatggcacaattcaagga
ctgttggaaatgatgcaacgtccctacgtggggtctggggtggcggcctccgccattggc
atggataaaattttaatgaaaacgttttttggagcggtggggctaccgcaagtgcagtat
gtggcgatcagccgctcagaactttggtcggatccgtgccgctatcgtcaggtgtgcgat
cgcatcgaaaccgaattgggctacccctgctttgtcaagccggccaaccttggctcatca
gtgggcatttctaaagccaagaatcgccaacagttgaccactgccctagaaaccgccgcc
gaactagatcggcgcatcattgtggaagcgggggtagtagcgcgagaactcgagtgtgcc
gtcctcggcaatgatgccccccaagcctcagtcgtgggtgaaatcacctacagtagcgaa
ttctacgactacgaaaccaaatatacggatggccgagctgatctgaagattccggcagat
attccagcgacggtgagtaacaccattcaggacatggcgctgaaagcctttacagccttg
gatggggctggtctagcacggtttgactttttttacctcccagacaatggccaaatttta
attaacgaagtcaataccttaccagggtttacggcactgagtatgtacccgcagttgtgg
gctgccagtggcctatcgtttccagaactggtgcatcggctcgtgcaattagcgcttgag
cgacacagagggatagcttggtag

DBGET integrated database retrieval system