KEGG   Streptomyces lavendulae: SLAV_00275Help
Entry
SLAV_00275        CDS       T05314                                 

Gene name
ddlB1
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slx  Streptomyces lavendulae
Pathway
slx00473  D-Alanine metabolism
slx00550  Peptidoglycan biosynthesis
slx01100  Metabolic pathways
slx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SLAV_00275 (ddlB1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLAV_00275 (ddlB1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SLAV_00275 (ddlB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slx01011]
    SLAV_00275 (ddlB1)
Enzymes [BR:slx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SLAV_00275 (ddlB1)
Peptidoglycan biosynthesis and degradation proteins [BR:slx01011]
 Precursor biosynthesis
  Amino acid ligase
   SLAV_00275 (ddlB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 ATP-grasp TTL ATPgrasp_ST RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ATZ21985
UniProt: A0A2K8P8P7
LinkDB All DBs
Position
54218..54571
Genome map
AA seq 117 aa AA seqDB search
MLPLLACETDRAFYDYEAKHDQGLRRETCPAALPEDVEQRVMETALRVHRLIGAHGVSRV
DFLVCSDGRSLVLEVNTVPGLSEHGNLATMAAAAGVSYVELIKRVLDTAFTKVSYVP
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgctgctggcctgtgagacagatcgcgcgttctatgactacgaggcgaagcac
gaccaggggcttcgccgcgaaacatgtccggccgccctgcccgaggacgtggagcagcgt
gtgatggagaccgcgctgcgggtgcaccggctgatcggcgcgcacggggtgagtcgggtg
gacttcctcgtctgctcggacggccggagcctggtcctggaagtgaacacggtgcctggc
ctctcggagcacgggaatctcgcgacgatggcggctgcggcgggcgtgtcgtacgtcgag
ctgatcaagcgggtgctcgacaccgcgttcaccaaggtctcgtacgtgccgtga

DBGET integrated database retrieval system