KEGG   Streptomyces lavendulae: SLAV_04425Help
Entry
SLAV_04425        CDS       T05314                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slx  Streptomyces lavendulae
Pathway
slx00250  Alanine, aspartate and glutamate metabolism
slx00410  beta-Alanine metabolism
slx00430  Taurine and hypotaurine metabolism
slx00650  Butanoate metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx02024  Quorum sensing
Module
slx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLAV_04425 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLAV_04425 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLAV_04425 (gadB)
   00430 Taurine and hypotaurine metabolism
    SLAV_04425 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLAV_04425 (gadB)
Enzymes [BR:slx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLAV_04425 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ATZ22792
UniProt: A0A2K8P7S0
LinkDB All DBs
Position
complement(994031..995422)
Genome map
AA seq 463 aa AA seqDB search
MALHETKDARARDADTDVFTSALSGQILPKYRMPEDHSPSEVVYSLLHNELLLDGNAAQN
LATFCTTWSDDGVHRLMNECLDKNMIDKDEYPQTAEIEARCVNILADLWNAPKGTSGTGC
STTGSSEAAMLGGLALKWRWRARRRAEGKPADRPNLVCGPVQICWEKFARYFDVELRQVP
LEPGATGLVPHQLAAHVDENTIGVVAILGVTYTCDYEPVAEIAAELDRIQEEHGWDIPVH
VDAASGGFVAPFLHPDVVWDFRLPRVASVNTSGHKYGLAPLGVGWIVWRTAELLPADLVF
DVDYLGGDMPTFALNFSRPGGEVIAQYYLFLRLGRGGYRRVQQACADTAQYLAGEIAGMG
PFTLLYDGQGGLPAVSYTLADPAGAGFTLYDLSDRLRMRGWQVPTYPLPADRQDTVMQRV
LIRHGVTRDQIALLVSDLRAAVEHLAAHPQPVPATEPRSGFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcatgagacgaaggacgcgcgtgcccgggacgccgatacggacgtgttcacg
tccgccctcagcggccagatcctcccgaagtaccggatgcccgaggaccactcgccctcc
gaggtggtctactcgctgctccacaacgagctgctcctcgacggcaacgccgcccagaac
ctggccaccttctgcaccacctggtcggacgacggcgtgcaccgcctgatgaacgagtgc
ctcgacaagaacatgatcgacaaggacgagtacccgcagacggccgagatcgaggcccgc
tgcgtcaacatcctggccgacctctggaacgccccgaagggcacctccggcaccggctgc
tccaccaccggctccagcgaggccgccatgctcggcggcctcgccctcaaatggcgctgg
cgggcccgccgccgggcggagggcaaaccggccgaccggcccaacctggtctgcggcccg
gtacagatctgctgggagaagttcgcccgctacttcgacgtcgagctccggcaggtcccc
ctggagcccggcgcgaccggcctggtcccccaccagctcgccgcccacgtcgacgagaac
accatcggggtcgtcgccatcctcggcgtcacctacacctgcgactacgaacccgtcgcc
gagatcgccgccgagctcgaccggatccaggaggagcacggctgggacatccccgtccac
gtggacgccgcgagcggcggcttcgtcgcccccttcctccaccccgacgtggtgtgggac
ttccggctgccgcgcgtggcctcggtcaacacctccgggcacaagtacgggctcgccccg
ctcggcgtcggctggatcgtctggcgcaccgccgagctgctccccgccgacctcgtcttc
gacgtggactacctcggcggcgacatgccgaccttcgccctcaacttctcccgccccggc
ggagaggtcatcgcccagtactacctcttcctgcggctgggccgcggcggctaccggcgc
gtccagcaggcctgcgccgacaccgcccagtacctggccggcgagatcgccggcatgggc
cccttcaccctgctctacgacggccagggcgggctgcccgccgtctcgtacacgctcgcc
gacccggccggcgccgggttcaccctctacgacctctccgaccggctgcggatgcgcggc
tggcaggtgcccacgtacccgctcccggcggaccgtcaggacaccgtcatgcagcgcgtc
ctgatccggcacggggtgacccgcgaccagatcgccctgctcgtcagcgacctgcgggcg
gccgtcgaacacctcgccgcccacccgcagccggtccccgccaccgaaccccggtcgggc
ttccaccactga

DBGET integrated database retrieval system