KEGG   Streptomyces lavendulae: SLAV_07665Help
Entry
SLAV_07665        CDS       T05314                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
slx  Streptomyces lavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ATZ23435
UniProt: A0A2K8PCR1
LinkDB All DBs
Position
1690253..1691305
Genome map
AA seq 350 aa AA seqDB search
MPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVHRDGDELEIGSRTGKTLTRYFPELVAAL
KENLPPRCVVDGEIVIVQGGRLDFDRLTERIHPAASRVKLLAETTPASFVAFDLLALDDG
SLLDTPLADRRTALVNALSTARPPVHLAPATTDPALAREWFERFEGAGLDGVVAKPLDLP
YRPDARLMFKIKHERTADVVLAGFRFHKSGPIVGSLLLGLYDDRGALQHVGVCAAFPMKR
RAELVEELDPLRMPDPEGHPWAAWTEESAHESARLPGAQSRWTGKKDLSWVPLRPERVCE
VKYDHMEGDRFRHTAQFARWRPDRTPETCTYAQLEEVVGYDLAEVLGTGG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgtgaagccgatgctcgccaagtccgtggcgaagatcccgcccggaatgcag
tacgaggcgaagtgggacggtttccgcgccatcgtccaccgcgacggcgacgagctggag
atcggcagccgcacgggaaagaccctgacccggtacttcccggagctggtggcggccctc
aaggagaacctgccgccccgttgcgtggtggacggggagatcgtgatcgtgcagggcggt
cggctcgacttcgatcggctcacggagcggatccaccccgccgcgtcccgcgtgaaactc
ctcgccgagaccaccccggccagcttcgtggccttcgacctgctcgccctcgacgacggg
tccctgctggacaccccgctcgccgaccgccgtaccgccctggtcaacgccctttccacc
gctcggccccccgttcacctcgcgcccgcgaccaccgaccccgcgctcgcgcgggagtgg
ttcgagcggttcgaaggcgccggactcgacggggtcgtcgcgaaacccctcgacctcccc
taccggcccgacgcccgcctgatgttcaagatcaagcacgagcgtacggccgatgtcgtc
ctcgcgggtttccgtttccacaagagcggtccgattgtcggatcgctgctcctgggcctg
tacgacgaccggggcgcgctccagcacgtgggggtctgcgccgccttccccatgaagcgc
cgcgccgagctggtcgaggaactggaccccctgcgcatgcccgacccggaaggacacccc
tgggcggcctggaccgaggagtcggcgcacgagagcgcccgcctcccgggcgcgcagagc
cggtggaccggcaagaaggacctgtcctgggtccccctgcgcccggagcgggtctgcgag
gtgaagtacgaccacatggagggcgaccgcttccgccacaccgcccagttcgcccggtgg
cgccccgaccgcaccccggagacctgcacgtacgcccagctggaggaggtcgtcggctac
gacctcgccgaggtgctggggaccggcgggtag

DBGET integrated database retrieval system