KEGG   Streptomyces lavendulae: SLAV_08215Help
Entry
SLAV_08215        CDS       T05314                                 

Gene name
eryA4
Definition
(GenBank) Erythronolide synthase, modules 3 and 4
Organism
slx  Streptomyces lavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thioesterase Thiolase_N Epimerase Docking Polysacc_synt_2 GDP_Man_Dehyd NmrA 3Beta_HSD Abhydrolase_1 NAD_binding_4 Abhydrolase_3 SAT
Motif
Other DBs
NCBI-ProteinID: ATZ23542
UniProt: A0A2K8P9W6
LinkDB All DBs
Position
complement(1820397..1837238)
Genome map
AA seq 5613 aa AA seqDB search
MNEEKLRYFLKRVTADLHETRRRLQEVESEEQEPIAIIGMSCRYPGDVESPEDLWRLVSE
ETDAISAFPTDRGWDTGSLFDEDPDGRGTSYVREGGFLHSANRFEPEFFGISPREAVAMD
PQQRLLLEIAWEAFERAGIDPTSVRGSRTGVFTGVMYHDYASRLRAVPPEVEGYLGTGGS
SSIASGRVSYTFGLEGPALTVDTACSSSLVTLHLAMQALRKGECSLALAGGVTVMPTPGT
FTEFSRQRGLSFDGRCKSFADAADGTGWGEGAGMLLVERLSDARRNGHRVLAVVRGSAVN
QDGASNGLTAPNGPSQQRVIRQALADARLTGADVDVVEAHGTGTTLGDPIEAQALLATYG
REHTEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAIRHGRIPKSLHVDEPSTKVDWAAG
AVSLLRTTVDWPDTGRPRRAAVSSFGISGTNAHTIIEQAPTEVPADAAATDAAGTESETG
TETGTETAETAAPQRRTVVPPVLPWPVSARTEAALRAQAERLLTHLRAHPDQSAADISRS
LATGRAALEHRAVVVAGDRDRALADLAALASEEETAATRVVRGEAGARGKTAFLFTGQGS
QRLGMGRELYDAYAVFAEALDAVCERLSLELPLKGVLFGTDAKLLDRTEYTQPALFAVEV
ALFRLLESWGVRPDFVSGHSVGEIAAAHVAGVLSLDDACALVSARGRLMQALPAGGVMIA
LEASEDEVLPLLTGRVSIAAVNGPRAVVIAGDEDAATAIVEAFPDRKSKRLTVSHAFHSP
HMDDMLEDFRRVVAGLTYGAPQIPVVSNLTGALVSDEMGSAEFWVRHVREAVRFLDGIRA
LEAAGVTTYVELGPDGVLSAMAQACLADDTGTAAFVPTLRKDRPEAETAVTALAHVHVHV
RGIAVDWQSYHRDTGAEHVDLPTYAFQREHYWLDAGTLGGDVTTAGLRSADHPLLGASVT
LADADGLLLTGRLSLPTHPWLADHRVMGSALLPGTAFVEFALHAGERVGCDLVDELTVAA
PLVLPEEGAVELQITVGAPDEAGRRPVVFHSRDSLAAYDEPWVRNATATLAQGAEEKQAC
DLNVWPPTGAAPVDIEGLYEGLADSGFGYGPVFQGLRAAWRRGEEVFAEVGLGDETDPGA
EQFTIHPALLDSALHAIGLGSLVEDTGRGQLPFSWSGVAVHSTGADTLRVRLSKAGQQSV
RLDMADIDGAPVATVDSLALRAFSPEQFGRPAGGHGDSLFGVDWTEAASAAAGSADTWMM
LGEGAQVFADLAGLGVAVVEGGEIPSALVVPCTEPAGADVAAAVHAETGRVLALVKEWLT
DDRFSGSRLVFLTRGAVEAVPGEGVSDLVHAPVRGLVRSAQSENPGRIILVDVDADADGE
VEQALSSALASGESEVAVRGGSVLVPRLARAAVAADAAPAWDAEGTVLVTGASGSLGGLF
ARHLVAEHGVRHLLLVSRRGEAASGAVELSAELAELGAEVAWAACDVADRDALAAVLAGI
PAERPLSAVVHTAGVLDDGVLGSLTAERLSAVLRPKVDATWNLHELTAGLDLSAFVLFSS
AAGVFGGAGQANYAAANTFLDALAAHRRAQGLAATSLAWGLWAEVGGMGGALDAEDVSRM
GRGGVNALTAAEGLALFDTACASGQALLAPVKLDLAALRAAAGGGMLPPLLSGLVRMPAR
RAARGGGGAFARQLAALPQEQQAGAVLGLVRGQVAAVLGFAGPEAVEPARSFSEVGFDSL
TAVELRNRLGAATGVRLPATLVFDYPTPAVLGEYLHAELLGSQEADTAPTAVAVHDDEPI
AIVAMACRFPGDVRSPEDLWRLVRDGRDAISDMPADRGWDLEALFDADPDRQGTSYSTAG
GFLHDAHHFDPTFFGISPREALATDPQQRLLLETSWEAFERARIDPASMRGSRTGVFAGV
MYNDYGTLLHRAPEGLEGYMGTSSSGSVASGRVSYTFGLEGPAVTVDTACSSSLVTLHLA
VQALRNGECDLALAGGVTVMATPGTFIAFSRQRGLATDGRCKPFAAAADGTAWGEGVGML
LVERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASAGLTSADVD
VVEAHGTGTTLGDPIEAQALLATYGQDRAADRPLLLGSIKSNFGHTQAAAGVAGVIKMIM
AMRHGTVPKTLHVDEPSPHVDWSEGAVELLTESVAWPETGRPRRAAVSSFGISGTNAHTI
IEQAPDEAAVAAAETDAAPAFPYVLSAKSTDALSAQAARLRTHLQDTPEAGAADMAYSLA
TRRAAFAHRAVIVAGAREELLGALAALENGDVTAAGITCGTVGAAGAGKLAFLFTGQGSQ
RLGMGRELYEVQPVFAAALDAVCERLELPLKKALFGADAGLLDETRYTQPALFAVEVALF
RLLESWGVRPDFVSGHSVGEIAAAHVAGVLSLDDACTLVEARGRLMQALPAGGVMIALEA
SEDEVLPLLTDRVSIAAINGPRSVVIAGDEDAAVAIAEAFPDRKSKRLTVSHAFHSPHMD
GMLDAFRRVAQGLTYAAPRIPVVSNLTGALVSDEMGSADFWVRHVREAVRFLDGIRALEA
AGVTTYLELGPDGVLSAMAQTCLADETRAAVFAPALRKERPETGTLTAAVAEAHAHGAPV
DWESYFAGTGARSIDLPTYAFQHERYWIDLPVGSFADAAAAGLRPADHPLLGASVMLADA
DGLLLTGRLSVATHPWLADHVVMGAVTLPGTAFVELALRAGEQIGCDLVEELTLAAPLVL
AEDGGVELQIAVGAPDEAGRRPLAFHSRDALAAESALWLRNATATLAVSAEEPPVFDLAA
WPPAGAEPVDVEDLYEGFAESGFGYGPVFQGLRAAWRKGDEVFAEVGLGDEQGPDAEQFT
IHPALLDSVLHAIGLGSLVEDTGLPRLPFAWSGVAVHSTGADTLRVRLSRAGREAVRLEI
ADTDGVPVASVDSLALRAFSPEQLGRQVAGHGDALFRVEWRELMPSDALFGDWIMRDEAD
AQALDDLDAVPGALVLSCPAPDGPDVADAVHAEAARVLALLQRWLSDDRFADARLAFLTR
GAVTVAPGDGPADLVHAAVWGLVRSAQSENPGRIVLVDVDADGDAEQALSAALASGESEV
AVRGGVLLVPRLARASVAGLDPEWDAGGTVLVTGASGSLGGLFARHLVAEHGVRNLLLVS
RRGEAASGAAELSAELAELGAEVAWAACDVADRDALAAVLAGIPEERPLSAVVHTAGVLD
DGVVGSLTAERLSAVLRPKVDAAWNLHELTAGLDLSAFVLFSSAAGVFGGAGQANYAAAN
TFLDALAAHRRAQGLAATSLAWGLWAEAGGMGDTLDAGDVSRMGRGGVIALSAAEGVALF
DSACASGQALLVPVRLDLAALRAAARGGMLPPLLSGLVRMPSRRAARGGTAAGGAFARQL
TALPQDQRPGAVLELVRGQVAAVLGFAGPEAVDPARSFSEVGFDSLTAVELRNRLAAATG
VRLPATLVFDYPTPAVLGEYLHAELLGGQGTDVAAVAASVHDDEPIAIVAMACRFPGDVR
SPEDLWRLVADGRDAISAMPDDRGWDLAGILDPGQPGADYSPTGGFLHDAHHFDPTFFGI
SPREALATDPQQRLLLETSWEAFERAGIDPASMRGSRTGVFAGVMYNDYGTLLHRAPEGL
EGYMGTSSSGSVASGRVSYTFGLEGPAVTVDTACSSSLVTLHLAVQALRNGECDMALAGG
VTVMATPGTFIAFSIQRGLASDGRCKPFAAAADGTAWGEGVGMLLVERLSDARAKGHPVL
AVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLSAAEVDAVEAHGTGTTLGDPIE
AQALLATYGQDRPAEQPLLLGSIKSNIGHTQAAAGVAGVIKMVQAIRHGVLPKSLHVDEP
TPHVDWSAGAVSLLESATPWPETGRPRRAAVSSFGIGGTNAHTIIEQAPDEAVVTAAETG
TAPVLPYVVSAKSADAVRDQAARLRRHLEGAAGLRPADVALSLATTRAVFDHRAVVVAGD
RKELLRGLTALEDGTAAAGVTRGAVSTGKTVFVFPGQGSQWLGMAAGLLESSPVFAARIG
ECAKALEPFTDWSLVDVLRAADGAPSLDRVDVVQPALFAVMVSLAEVWRAAGVRPGAVIG
HSQGEIAAACVAGILSLEDAARVVALRSQAIGRVLAGLGGMVSVPLAAAEVRERIAPWGE
ERISVAAVNGPSSVVVSGEVQALEEFLAACETDGVRAKRIAVDYASHSAQVELLREELDT
LLAPIAPRAAGVPFLSTVTGEWVEGPELDGGYWFRNLRRTVELERATRTLLDQGFGVFIE
SSPHPVLTVGLQETVEDAGREAAVLGSLRRGEGGLERFWLSLGEAYVRGVTVDWDAVFAG
TGAQRVDLPTYAFQRDRFWIDVPVSAVGDVASAGLGKAEHPLLGAAVELPDSDGFLFTGR
LSLTTHPWLADHRAAGAVLLPGTAFVELALHAAQRAGSTVLEELTLEAPLVLPERGALQL
RLSVAAPDADGRRALHVYSRPEARHGEDGRGSESEPWTRHAAGVLGAADTPAAAPAPAPR
TWPPAGADELEVDDLYELFAAGGYAYGPAFRNLRAAWRLGDELFAELSLAEGPQADAAHF
GVHPALLDAGLHGLALGSFLTADDEEPGAEARMRLPFAFTGVGLHAVGADALRVRLAPAG
SGAVSLTAFDEQGEPVVSVESLLLRTLDPAALTSARSAFHESLFRLEWPVVPAAAADPAA
TAGRWALVGPDTLGLEAALRGADATADVYGDLDALGAVVTAGQPAPDTVLVTYAMPGAGA
AEGPQDTAGAARQATRDALALVQAWLAEEAFAGSRLAVLTRGAVEALPGEGVADLAHASV
WGLLRSAQSENPGRFLLIDLDAGADAARAEHPALLAAAVASGEPQLALRGGALHAARLAR
VRAERPEPQEAAEEGAAAEAARPVPVPVPVPDPDGTVLITGGTGVLGSLLARHLVTEHGA
RRLLLTSRRGPRAAGAAELVAELAALGAEAAVVACDASDREALAALLAGIPAEHPLTAVV
HTAGHLDDGLVPSLTPERIDSVLRPKVDAALHLHELTRDLDLAAFVLFSSAAGTLGSPGQ
ANYAAANAFLDALAHSRRAEGLPAVSLAWGLWEQRSEMTGELTDADVQRMARAGLAPLTS
EQGLALFDTACGPAAGSVFLAIRLDTAPLRAQAESGALPAVFRGLVRGGLRKAAAHGAGT
AAASAAAQLLAGLSALPEEEQERVLLDVVRAQAAAVLAYPSPEAVGESQEFLELGLDSLT
AVELRNQLNAATGLRLPATLLFDHPTPLLVAQRLRAELAEGPGVPAGAAGTAERDAEEDA
GVFGAMLQEAGTQGASGQFMELLMQASRFRPSFSSAAELRRAPALVRLARGEEGPGLVCF
SSILSISGPHQYARFASAFRGRRDVHAMAAPGFLRGEQLPSTAGAVIEAQAEAVLRHTDG
APFVLLGHSSGGMLAHAVAGRLEDAGVFPEAVVLIDIYSHDDDAILGIQPGLSEGVDERQ
GSYVPVDDSRLLAMGAYFRLFGGWKPQAVKSPTLLVRAEERFFDWKRAATGDWRSYWDLE
HTAVDAPGNHFTMMEQHAQETAGAVGQWLDARS
NT seq 16842 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggaaaagctccggtacttcctgaagcgggtaacggccgatctccacgagacg
cgccgccgcctccaggaggtcgagtcggaggaacaggagccgatcgcgatcatcggaatg
agctgccgctatccgggagacgtcgagtcccccgaggacctgtggcggctggtgtccgag
gagaccgacgcgatctcggccttcccgacggaccggggctgggacacggggagcctgttc
gacgaggaccccgacgggcggggcacgagctacgtgcgcgaaggcggcttcctgcactcc
gccaaccgcttcgagccggagttcttcggcatctccccccgtgaagccgtggcgatggac
ccgcagcagcgcctgctgctggaaatcgcctgggaggccttcgaacgcgccggtatcgac
ccgacctcggtgcgcggcagccgcaccggcgtcttcaccggcgtcatgtaccacgactac
gcctcgcggctgcgcgccgtaccgccggaggtcgagggctacctcggcaccggcggctcc
agcagcatcgcctccggccgcgtctcgtacacgttcggcctggagggcccggcgctcacc
gtcgacaccgcctgctcctcctccctcgtgacgctccacctggccatgcaggcgctgcgc
aagggcgagtgctcgctcgccctcgcgggcggcgtcaccgtcatgccgacgcccggcacc
ttcaccgagttcagccgccagcgcggcctgtccttcgacggccgctgcaagtccttcgcg
gacgccgccgacggcaccggctggggcgagggcgcgggcatgctcctcgtggaacgcctc
tccgacgcccgccgcaacggccaccgcgtgctcgcggtggtccgcggctcggcggtcaac
caggacggcgcctccaacggcctcacggcccccaacggcccgtcccagcagcgcgtcatc
cgccaggccctggccgacgcccgcctcaccggcgcggacgtcgacgtggtcgaggcgcac
ggcaccggcaccaccctcggcgaccccatcgaggcgcaggccctgctggccacgtacggc
cgggagcacaccgaggaccgcccgctgtggctgggctccgtgaagtccaacatcggacac
acgcaggccgccgccggcgtggccggcgtcatcaagatggtcatggcgatccgccacggc
cggatcccgaagtccctccacgtggacgagccctcgaccaaggtcgactgggccgcgggc
gccgtgtcgctgctgcgcaccaccgtggactggccggacaccggtcgcccgcgccgcgcg
gccgtctcctcgttcggcatcagcggcacgaacgcgcacaccatcatcgagcaggccccc
accgaggtccccgccgacgcggcggcgaccgacgcggccgggaccgagtcggagaccggg
accgagaccgggaccgagaccgccgagacggcggccccgcagcgccgcaccgtcgtaccg
cccgtactgccgtggcccgtctcggcccgtacggaagccgccctgcgcgcccaggccgaa
cgcctgctcacccacctgcgcgcccaccccgaccagtcggcggcggacatcagccgctcc
ctggccaccggccgcgccgccctcgaacaccgcgccgtcgtcgtggccggcgaccgcgac
cgcgccctcgccgacctggcggcactggcctccgaggaggagaccgccgcgacgcgcgtc
gtccggggcgaggccggagcacgcggcaagactgccttcctgttcaccggtcagggcagt
cagcgcctggggatggggcgtgagctgtatgacgcctatgcggtgttcgcggaggcgctg
gacgcggtgtgcgagcggctctcgctcgaactgccgctgaagggcgtgctgttcggtacg
gatgcgaagctgctggaccgtactgagtacacccagcccgcgctgttcgccgtcgaggtg
gcgctcttccggctgctggagtcgtggggtgtgcggccggacttcgtgtcgggtcattcg
gtcggtgagatcgccgccgcgcatgtggcgggtgtgttgtcgctggacgacgcgtgcgcg
ctcgtgtccgcccgtgggcggctgatgcaggcgctgccggccggtggggtgatgatcgcg
ctggaggcgtcggaggacgaggtcctgccgctgctgaccggccgggtgagcatcgccgcc
gtcaacgggccgcgcgcggtcgtgatcgccggtgacgaggacgcggcgaccgcgatcgtg
gaagccttcccggaccggaagtccaagcggctgacggtgagccacgcgttccactcgccg
cacatggacgacatgctggaggacttccgccgggttgtggccgggctgacctatggcgcc
ccgcagattccggtggtctcgaacctgaccggtgccctggtctccgatgagatgggctcg
gccgagttctgggtgcggcacgtccgcgaggcggtccgcttcctcgacggcatccgcgcc
ctggaggcggcgggcgtgaccacgtacgtcgagctcggacccgacggggtgctgtccgcg
atggcgcaggcctgcctggccgacgacaccggcaccgccgccttcgtacccaccctgcga
aaggaccgtcccgaggcggagaccgccgtcacggccctcgcccacgtccacgtccacgtc
cggggcatcgccgtcgactggcagtcctatcaccgtgacaccggcgccgagcacgtcgac
ctgcccacctatgccttccagcgcgagcactactggctcgacgccggaaccctcggcggc
gacgtgaccaccgccggactccggtccgcagaccaccccctgctcggcgcctcggtgacg
ctggcggacgccgacggcctgctcctcaccgggcgactgtcactgcccacccacccctgg
ctcgcggaccaccgcgtcatgggctccgcgctgctcccgggcacggccttcgtcgagttc
gcccttcatgccggtgagcgcgtcggctgcgacctggtcgacgaactgaccgtcgcggcg
ccgctcgtgttgcccgaggaaggcgccgtcgagctccagatcaccgtcggagcgcccgac
gaggcgggccgccgcccggtcgtcttccactcgcgcgacagcctggcggcctacgacgag
ccgtgggtccgcaacgccaccgcgacactggcgcagggcgcggaggagaagcaggcctgc
gacctcaacgtctggccgcccaccggtgcggcacccgttgacatcgaaggcctgtacgag
ggcctcgcggactccggcttcggctacgggccggtgttccagggcctgcgggccgcctgg
cggcgcggcgaggaggtgttcgccgaggtggggctcggcgacgaaaccgacccgggcgcc
gagcagttcacgatccaccccgcgctcctcgactccgccctgcacgccatcggcctcggc
tccctcgtggaggacaccggccggggccagctgcccttctcctggtccggggtcgcggtc
cactccaccggagcggacaccctgcgcgtgcgcctctccaaggcgggtcagcagtccgta
cggctggacatggccgacatcgacggcgcgcccgtcgcgacggtggacagcctggccctc
cgggccttctcgcccgagcagttcggccgcccggccggtgggcacggcgactccctgttc
ggtgtcgattggacggaggcggcctcggcggcggccggttccgccgacacctggatgatg
cttggcgagggcgcgcaggtcttcgccgacctcgccgggctgggcgtggcggtggtcgag
ggcggggagatcccgtccgcgctggtcgtgccgtgcaccgagcccgccggcgcggacgtg
gccgccgcggtgcacgccgagaccgggcgcgtgctcgcgctggtcaaggaatggctgacc
gacgaccgcttctccggctctcgcctggtgttcctgacgcggggtgcggtggaggccgtg
ccgggtgagggtgtgtcggacctcgtccacgctccggtacggggcctggtgcggtcggcg
cagtcggagaacccggggcggatcatcctggtggacgtggatgccgacgccgatggcgag
gtggagcaggcgctgtcctccgcactggcgtcgggtgagtccgaggtggcggtgcgcggt
ggatcggtgctggtgccgaggctggcgcgggctgcggtcgcggctgacgcggcccctgcc
tgggatgccgagggcacggtgctggtgacgggtgcgagtggttcgctgggtggtctgttc
gcccggcatctggtggccgagcacggggtacgtcacctgctgttggtgagtcgtcgtggt
gaggcggcttcgggtgcggtggagttgtctgcggagctggctgagctgggtgcggaggtg
gcgtgggcggcgtgtgatgtcgccgaccgtgacgcgctggctgctgtcctggccgggatt
ccggcggagcgtccgttgtcggcggtcgtgcacacggccggtgttctggacgacggtgtg
ctgggttccctgacggctgagcggttgtcggcggtgttgcgtccgaaggtggacgcgacg
tggaacctgcacgagctgaccgccggtctcgacctgtcggcgttcgtcctgttctcctcg
gccgctggtgtgttcggtggtgcgggccaggccaactatgcggcggccaacaccttcctg
gacgccctcgccgcgcaccgccgggcccagggcctggctgcgacctccctcgcctggggt
ctgtgggccgaagtgggcggcatgggtggcgcgctggacgccgaggacgtttcgcgcatg
ggtcgtggcggggtcaacgcccttaccgcggccgagggtctggccctgttcgacaccgcc
tgcgcctccggccaggccctgctggcacccgtcaagcttgacctggccgccctgcgtgcc
gcggccggagggggcatgctcccgccgctgctctccggcctcgtccggatgccggcccgt
cgggccgcccggggcggcggcggcgcgttcgcccgacagctcgctgccctgccgcaggag
cagcaggccggcgccgtcctcggactggtccgaggacaggtcgcggccgtactcggcttc
gcggggccggaggcggtggagccggcgcggtcgttcagcgaggtcggcttcgactcgctg
accgccgtcgaactgcgcaaccgcctcggtgccgccaccggcgtacgcctgcccgccacc
ctcgtcttcgactacccgacgcccgccgtcctgggggagtacctgcacgccgaactgctc
ggcagccaggaagcggacacggctccgaccgccgtcgccgtgcacgatgacgagccgatc
gccatcgtggcgatggcctgccgcttcccgggcgacgtccgctcgcccgaggacctgtgg
cgactcgtccgcgacgggcgggacgccatctcggacatgcccgccgaccggggctgggac
ctcgaagccctcttcgacgccgacccggaccgccagggcaccagctacagcacggccggc
gggttcctgcacgacgcgcaccacttcgacccgacgttcttcgggatctcgccgcgcgag
gccctggcgaccgacccgcagcagcggctgctgctggagacctcctgggaggccttcgag
cgggcccgcatcgatccggcctcgatgcgcggcagccggaccggcgtgttcgcgggtgtc
atgtacaacgactacggcacgctcctgcaccgggccccggagggcctggaggggtacatg
gggacgtccagctcgggcagtgtcgcctcgggccgcgtctcgtacacgttcggcctggag
ggcccggcggtcaccgtcgacacggcctgctcctcctcgctcgtcaccctccacctcgcc
gtccaggccctccgcaacggcgaatgcgacctcgcgctcgcgggcggtgtgacagtgatg
gccacgcccggcaccttcatcgccttcagccggcagcgcggcctcgcgacggacggccgc
tgcaagcccttcgccgccgccgccgacggcaccgcctggggcgagggcgtcggcatgctc
ctcgtcgagcggctctcggacgcccgccgcaacgggcacccggtgctcgcggtggtccgc
ggctcggcggtcaaccaggacggcgcctccaacgggctgaccgcccccaacggcccgtcc
cagcagcgcgtcatccgtcaggccctcgccagcgcgggcctgacctccgccgacgtcgac
gtggtcgaggcgcacggcacgggcacgacgctcggcgacccgatcgaggcccaggcgctg
ctggccacgtacggccaggaccgagcggcggaccgtcctctgctgctgggctcgatcaag
tccaacttcggccacacgcaggccgccgccggtgtcgccggcgtgatcaagatgatcatg
gcgatgcggcacgggacggtgccgaagacgctgcacgtggacgagccctccccgcacgtc
gactggtccgagggtgccgtcgagctgctgacggagtcggtggcctggccggagaccggc
cgtccgcgccgcgcggccgtgtcctccttcggcatcagcggcaccaacgcgcacaccatc
atcgagcaggccccggacgaggccgcggtggccgcggccgagacggacgcggcgccggcg
ttcccgtacgtgctgtccgcgaagtcgacggacgcgctgagcgcccaggcggcccgcctg
cggacccacctgcaggacacgcccgaggccggcgcggccgacatggcctactcgctggcc
acccgtcgcgctgccttcgcccaccgtgcggtgatcgtggccggtgcccgggaagaactg
ctcggcgcgctggccgcgctggagaacggcgacgtgaccgccgccgggatcacctgcggc
acggtgggcgccgccggagccggcaaactcgcgttcctgttcacggggcagggcagccag
cgcctggggatgggtcgtgaactgtacgaggttcagccggtgttcgccgccgcgctggat
gcggtgtgcgagcggctggaacttccgctgaagaaagcgctgttcggtgcggatgccggt
ctcctggacgagacgcgctatacccagcccgcgctgttcgccgtcgaggtggcgctgttc
cggctgctggagtcgtggggtgtgaggccggacttcgtgtccgggcattcggtcggtgag
atcgccgccgcgcacgtggcgggggtgctgtcgctggacgacgcgtgcacgctggtggag
gcccgtgggcggctgatgcaggcgctgccggccggtggggtgatgatcgcgctggaggct
tcggaggacgaggtcctgccgctgctgaccgaccgggtcagcatcgcggcgatcaacggg
ccgcgctcggtcgtgatcgccggtgacgaggacgcggccgtcgcgatcgcggaagccttc
cccgaccggaagtccaagcggctgaccgtcagccacgccttccactccccgcacatggac
ggcatgctcgacgccttccgccgggtcgcgcaggggctcacctacgccgccccgcggatc
ccggtggtctccaacctgaccggtgccctggtctccgacgagatgggctcggcggacttc
tgggtgcggcacgtccgcgaggcggtccgcttcctcgacggcatccgcgccctggaagcc
gcgggcgtgaccacgtacctcgaactcggccccgacggagtcctctccgccatggcgcag
acctgcctggccgacgagacgcgtgctgccgtgttcgcccccgccctgcgcaaggagcgc
cccgagacgggcaccctcacggccgccgtcgccgaggcccacgcccacggggcccccgtc
gactgggagtcgtacttcgcgggcaccggtgcccggagcatcgacctgccgacctacgcc
ttccagcacgagcggtactggatcgacctccccgtcggatccttcgccgacgcggccgcc
gcgggcctgcggcccgccgaccaccccctgctcggcgcctcggtgatgctggcggacgcc
gacggcctgctcctcaccgggcggctgtccgtcgccacccacccctggctcgcggaccac
gtggtcatgggagcggtgacgctccccggtacggcgttcgtcgagctggcgctgcgcgcc
ggtgagcagatcggctgcgacctggtggaagagctgaccctcgccgcccccctcgtcctc
gccgaggacggcggcgtcgagctccagatcgccgtcggtgcccccgacgaggcgggccgc
cggcccctggccttccactcgcgcgacgccctggcggcggagagtgccctctggctccgc
aacgccaccgcgaccctcgcggtgagtgcggaggagcctccggtgttcgacctcgcggcc
tggcccccggccggcgcggagcccgtcgacgtcgaggatctgtacgagggcttcgccgag
tccggcttcggctacgggccggtgttccagggcctgcgggccgcctggcgcaagggcgac
gaggtgttcgccgaggtcggcctcggcgacgagcagggcccggacgccgagcagttcacg
atccacccggcgctcctcgactccgttctgcacgccatcggcctcggctccctcgtggag
gacaccggtctgccgcggctgccgttcgcctggtccggggtcgcggtccactccacggga
gcggacaccctgcgcgtacggctctcccgggccggacgcgaggcggtgcgtctggagatc
gccgacaccgacggtgtcccggtcgcctcggtggacagcctcgctctgcgcgccttctcg
ccggagcagctcggccggcaggtcgccggccacggcgatgcgctgttccgcgtcgagtgg
cgcgaactgatgccttccgacgcactgttcggcgactggatcatgcgggacgaggccgac
gcgcaggccctcgacgacctcgacgcggtgccgggtgcgctggtgctgtcgtgcccggcg
cccgacggcccggacgtggccgacgcggtgcacgccgaggcggcccgggtgctggcgctg
ctccagcggtggctgtccgacgaccgtttcgccgatgcgcggctggcgttcctgacccgc
ggcgccgtgaccgtcgccccgggcgacggtcctgcggacctggtgcacgccgcggtgtgg
ggcctggtgcgctccgcgcagtcggagaacccgggccggatcgtcctggtggacgtcgac
gccgacggcgatgcggagcaggcgctctcggcggccctggcctcgggtgagtccgaggtg
gcggtgcgcgggggcgtgctgctcgtgccgcgcctggcgcgcgcgtcggtcgccggcttg
gatccggagtgggatgccggtggcacggtgctggtgacgggtgcgagtggttcgctgggt
ggtctgttcgcccggcacctggtggccgagcacggggtacggaatctgttgctggtgagt
cgtcgtggtgaggcggcttcgggtgctgccgagttgtcggcggagctggccgagctgggt
gcggaggtggcgtgggcggcctgtgacgtcgccgaccgcgacgcgctggctgctgtcctg
gcggggattccggaggagcgtccgttgtcggcggtcgtgcacacggccggtgttctggac
gacggtgtcgtgggctctctgacggctgagcggttgtcggcggtgttgcgtccgaaggtg
gacgcggcgtggaacctgcacgagctgaccgccggtctcgacctgtccgctttcgtcctg
ttctcctcggccgctggtgtgttcggtggtgcgggccaggccaactatgcggcggccaac
accttcctggacgccctcgccgcgcaccgccgggcccagggcctggccgcgacctccctc
gcctggggcctgtgggccgaggccggcggcatgggggacaccctggacgccggcgacgtc
tcacgcatgggccgcggtggcgtgatcgccctgagcgccgccgaaggcgtggccctgttc
gacagcgcctgcgcgtccggacaggcactgctggtgccggtccggctggatctggccgcc
ctgcgcgccgccgctcgcggcgggatgctcccgccgctgctctccggcctcgtccgcatg
ccctcgcggcgtgcggcccggggcggcacggccgcgggcggtgccttcgcccggcagctc
acggccctgccgcaggaccagcggccgggagccgtgctggagctggtccgaggacaggtc
gcggccgtactcggcttcgcggggccggaggcggtggatccggcgcggtcgttcagcgag
gtcggcttcgactcgctgaccgccgtcgaactgcgcaaccgcctcgcggcggcgacgggt
gtgcgcctgccggccaccctcgtcttcgactacccgacgcctgccgttctgggggagtac
ctgcacgccgagctgctcggcggccagggcacggacgtggccgcggtcgcggcctccgtg
cacgacgacgagccgatcgccatcgtggcgatggcctgccgcttccccggtgacgtccgc
tcgcccgaggacctgtggcgactcgtcgcggacgggcgggacgccatttccgccatgccg
gacgaccgcggctgggacctcgccggaatcctcgaccccggccagccgggcgccgactac
agcccgaccggcgggttcctgcacgacgcgcaccacttcgacccgacgttcttcgggatc
tcgccgcgcgaggccctggcgaccgacccgcagcagcggctgctgctggagacctcctgg
gaggccttcgagcgggccggcatcgacccggcctcgatgcgcggcagccggaccggcgtg
ttcgcgggtgtcatgtacaacgactacggcacgctcctgcaccgggccccggagggcctg
gaggggtacatggggacgtccagctcgggcagtgtcgcctcgggccgcgtctcgtacacg
ttcggcctggagggcccggcggtcaccgtcgacacggcctgctcctcctcgctcgtcacc
ctccacctcgccgtccaggccctgcgcaacggcgaatgcgacatggccctcgcgggcggt
gtgaccgtgatggccacgcccggcaccttcatcgcgttcagcatccagcgcggcctggcc
tccgacgggcgctgcaagcccttcgcggccgccgccgacggcaccgcctggggcgagggc
gtcggcatgctgctggtcgagcggctctcggacgcccgtgccaagggccacccggtcctc
gcggtggtccgcggctcggcggtcaaccaggacggcgcctccaacggcctcacggccccc
aacggcccctcccagcagcgcgtcatccgccaggccctggccaacgccggtctgtccgcc
gccgaggtggacgccgtcgaggcgcacggcacgggcacgacgctcggcgacccgatcgag
gcccaggccctcctggccacctacggccaggaccggccggccgagcagccgctgctgctc
ggctcgatcaagtccaacatcggccacacgcaggccgccgccggtgtggcgggcgtcatc
aagatggtccaggcgatacggcacggagtcctgccgaagtccctgcacgtggacgagccc
accccgcacgtggactggtcggcgggagcggtctcgctcctggagtcggccaccccctgg
ccggagaccgggcgcccgcgccgggcggccgtgtcctcgttcggcatcggcggcaccaac
gcgcacacgatcatcgagcaggccccggacgaggccgtggtgaccgcggccgagacgggt
accgcaccggtgctgccgtacgtggtgtccgcgaagtcggcggacgccgtgcgcgaccag
gcggcccgcctgcgcaggcacctggagggcgcggccgggctcaggcccgccgatgtggcg
ctctccctggccacgacccgggccgtcttcgaccaccgcgcggtggtcgttgccggggac
cggaaggaactgctgcgtggtctgaccgcgctggaggacgggaccgcggccgccggagtg
acgcgcggcgccgtgagcaccgggaagacggtgttcgtgttcccgggtcagggttcgcag
tggttggggatggcggctgggctgttggagtcctcgccggtgttcgcggcgcggatcggg
gagtgtgcgaaggcgctggagcctttcaccgactggtcgttggtggatgtgctgcgggcc
gccgacggcgcgccctccctcgaccgggtggatgtggtgcagccggcgctgttcgcggtg
atggtgtcgctggccgaggtgtggcgcgcggcgggtgtccggccgggtgcggtgatcggg
cattcccagggtgagatcgcggccgcgtgtgtggcggggatcttgtcgttggaggatgcg
gcccgtgtggtggccctgcggtcgcaggcgatcggccgggtgctggcggggctgggtggc
atggtgtcggtgccgctggccgctgccgaggtgcgtgagcggatcgccccgtggggtgag
gagcggatctccgtcgccgccgtgaacggcccgtcgtcggtcgtggtctcgggcgaggtc
caggcgctggaggagttcctggccgcgtgcgagacggacggggtccgtgcgaagcggatc
gcggtggactacgcctcccactcggcgcaggtcgagctgctgcgggaggaactggacacg
ctgctcgcgccgatcgcgccgcgggctgcgggggttccgttcctgtcgaccgtcaccggt
gagtgggtcgaaggccccgaactggacggtgggtactggttccgtaatctgcgtcggacg
gtggagctggagcgggccacgcggacgctgctcgatcaggggttcggtgtgttcatcgag
tccagcccgcatccggtgctgacggtcggtctgcaggagacggtcgaggacgcgggccgg
gaggccgctgtcctgggttccctgcggcgtggtgaaggtggtctggagcggttctggctc
tccctgggcgaggcctacgtacgcggtgtgacggtggactgggacgccgtgttcgccgga
acgggcgcgcaacgcgtggacctgcccacctacgccttccagcgcgaccgcttctggatc
gacgtaccggtctccgccgtcggcgacgtggcctccgccggactcggcaaggccgagcac
ccgctgctgggcgcggccgtcgaactgccggattcggacgggttcctcttcacgggccgc
ctgtccctcacgacccacccctggctggccgaccaccgcgccgccggtgccgtgctgctg
cccgggacggccttcgtggaactcgcgctgcacgccgcccagcgggccggcagcaccgtc
ctggaggaactgaccctggaagccccgctggtgctccccgagcgcggggcactccagctc
cggctgtcggtggcggccccggacgcggacgggaggcgggcactgcacgtgtactcgcgc
cccgaggcccggcacggcgaggacggccgaggctccgagagcgagccgtggacgcggcac
gccgccggtgtgctcggtgcggcggacaccccggccgcggcgccggccccggctccgcgg
acctggcccccggcgggcgccgacgagctcgaagtggacgacctgtacgagctgttcgcc
gccggcggatacgcgtacggaccggccttccgcaacctgcgggcggcctggcggctcggc
gacgagctcttcgccgaactctccctcgccgaaggcccgcaggccgatgccgcgcacttc
ggcgtgcacccggcgctgctggacgcgggcctgcacggcctcgccctcggctccttcctc
accgccgacgacgaggagcccggcgcggaggcccggatgcggctgcccttcgccttcacc
ggcgtaggcctgcacgccgtcggggcggacgcgctgcgggtgcggctggccccggccgga
tcgggggccgtgtccctcacggccttcgacgagcagggcgagcccgtcgtgtcggtggag
tcgctgctgctgcgcacgctcgacccggccgcgctgacgtcggcccggtccgcgttccac
gagtcgctgttccgcctggagtggcccgtcgttcccgccgcggccgccgaccccgcggcc
acggccggccgttgggccctggtcgggcccgacaccctcggtctggaggccgcgctgcgc
ggcgcggacgccaccgccgacgtctacggagacctcgacgccctcggcgccgtggtgacc
gccggacagccggcgccggacaccgtgctcgtcacgtacgccatgcccggagccggcgcc
gccgagggtccgcaggacacggccggggccgcccggcaggcgacccgcgacgccctcgcg
ctcgtacaggcctggctggccgaggaagcgttcgccggctcccgcctcgcggtgctcacc
cggggcgccgtcgaggcgctgccgggcgagggcgtggcggacctggcgcacgcctcggtc
tggggcctgctgcgctcggcgcagtcggagaaccccggccggttcctgctgatcgacctg
gacgccggagccgacgccgcgcgggcggaacaccccgcgctgctggcggccgccgtggcc
agtggcgaaccgcagctcgccctgcgcgggggagcgctgcacgccgcccggctggccagg
gtccgggcggagcgccccgagccgcaggaggccgccgaggaaggcgccgccgccgaggcc
gcgcggccggtaccggtaccggtccccgtaccggacccggacggtaccgtcctgatcacc
ggcggcaccggcgtgctcggcagcctcctggcccggcacctggtgaccgagcacggggcc
cggcgcctgctgctcaccagccggcgcggaccgcgtgcggccggcgcggcggaactcgtc
gcggaactcgccgcgctgggcgccgaggcggccgtcgtcgcctgcgacgcgtccgaccgg
gaggcactggcggccctgctggccgggatcccggccgagcacccgctcacggccgtcgtc
cacaccgcggggcacctcgacgacgggctcgtcccgtccctgacgcccgagcggatcgac
tcggtcctgcggcccaaggtggacgcggcgctgcacctgcacgagctgacccgggacctg
gacctggccgcgttcgtcctgttctcctcggccgcgggcaccctcggcagccccggccag
gccaactacgcggcggccaacgccttcctcgacgccctggcgcacagccggcgcgccgag
gggctgcccgccgtgtccctggcctggggactgtgggagcagcgcagcgagatgaccggc
gagctcaccgacgccgacgtgcagcggatggcgcgggccggtctggccccgctcacctcc
gagcagggcctggccctcttcgacacggcgtgcggtccggccgcgggcagcgtcttcctc
gccatccgcctggacaccgccccgctgcgggcccaggccgagtccggagccctgccggcg
gtcttccgggggctggtccggggtggtctgcgcaaggccgccgcgcacggcgccgggacg
gcggcggcctccgccgccgcgcagctcctcgcggggctgtcggcgctgccggaggaggag
caggagcgcgtcctgctcgacgtggtgcgggcgcaggccgccgcggtgctggcctacccc
tcgcccgaggcggtgggggagtcccaggagttcctggagctcggcctggactcgctgacc
gccgtcgagctgcgcaaccagctgaacgcggccaccggcctgcggctgcccgccaccctg
ctgttcgaccacccgaccccgctgctggtcgcgcagcggctgcgcgccgagctcgccgag
ggtccgggcgtgcccgccggggccgccgggacggcggagcgggacgcggaggaggacgcc
ggggtcttcggcgcgatgctccaggaggcggggacgcagggcgcgtccggccagttcatg
gaactgctgatgcaggcctcgcggttcaggccctcgttctcctcggcggccgagctgcgc
cgggcgcccgccctggtgcggctggcgcgcggtgaggagggtccggggctggtctgcttc
tcctcgatcctgtcgatctccgggccgcaccagtacgcccggttcgcctccgccttccgc
ggccggcgcgacgtccacgccatggcggcccccggcttcctgcggggcgagcagctgccc
tcgacggccggagcggtgatcgaggcccaggccgaggccgtcctgcggcacacggacggg
gcgccgttcgtgctcctcggacactcctcgggcggcatgctcgcccacgcggtcgccggg
cggctggaggatgccggggtcttccccgaggcggtcgtcctgatcgacatctactcgcac
gacgacgacgccatcctcggcatccagccggggctgtcggaaggcgtcgacgagcgtcag
ggcagctacgtcccggtggacgacagccgcctgctggcgatgggcgcctacttccggctc
ttcggcggctggaagccgcaggcggtgaagtcgcccacgctgctggtccgggccgaggag
cggttcttcgactggaagcgcgcggcgaccggcgactggcgttcctactgggacctggag
cacacggccgtggatgcccccggcaaccacttcacgatgatggagcagcacgcgcaggag
accgcgggagcggtcgggcagtggctggacgcccggtcctga

DBGET integrated database retrieval system