KEGG   Streptomyces lavendulae: SLAV_13055Help
Entry
SLAV_13055        CDS       T05314                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slx  Streptomyces lavendulae
Pathway
slx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SLAV_13055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:slx03400]
    SLAV_13055
Enzymes [BR:slx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLAV_13055
DNA repair and recombination proteins [BR:slx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SLAV_13055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ATZ24469
UniProt: A0A2K8PCM8
LinkDB All DBs
Position
complement(3088006..3088890)
Genome map
AA seq 294 aa AA seqDB search
MTPITMVEGRRIALSNLDKVLYPRTGFTKGEVLHYYATVADSLLAHIRDRPVSFLRYPDG
PDGQLFFTKNPPPGTPAWVRTTPVPRSEDAGAEQVVVGDLPTLMWAANLVVEFHTPQWTA
GRPAVADRIVFDLDPGPPATVVECCAAARWLRGRLAADGLDAYAKTSGSKGLHLAVPIEP
TPSARVSAYAKTLAQEAEAALPGLVLHRMARALRPGKVFVDHSQNAAAKTTAAPYTLRAR
ELPTVSAPVTWEEVEGCRTAADLVFLADDMAPRLARDGDLLAPLTDPARAGRLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatcaccatggtggaggggcgtcgcatcgcgctcagcaacctggacaaggtc
ctgtacccgcggaccggcttcaccaagggcgaggtgctgcactactacgccacggtcgcg
gactccctcctcgcgcacatccgcgaccgcccggtctccttcctgcgctatcccgacggt
ccggacggacagctcttcttcaccaagaacccgccgcccggtacgcccgcctgggtgagg
accacccccgtgccccgctccgaggacgcgggggccgaacaggtggtcgtcggcgacctg
cccaccctcatgtgggccgcgaacctcgtcgtggagttccacaccccccagtggacggcc
ggccgcccagccgtcgccgaccggatcgtcttcgacctcgaccccggcccgcccgccacc
gtcgtcgaatgctgcgccgccgcccgctggctgcgcgggcgcctcgccgccgacggcctc
gacgcctacgccaagacctccggctccaagggcctgcacctggccgtcccgatcgagccg
accccgtcggcgcgcgtgtccgcgtacgccaagaccctcgcccaggaggccgaggccgcc
ctccccggcctggtcctgcaccggatggcccgggccctgcgccccgggaaggtgttcgtg
gaccacagccagaacgccgccgccaagaccaccgccgccccctacaccctgcgcgcgcgg
gagctgcccaccgtctccgcccccgtcacctgggaggaggtcgagggctgccggaccgcc
gccgacctggtgttcctcgccgacgacatggcgccccggctggcccgcgacggcgacctg
ctggcccccctgaccgaccccgcccgcgcggggagactgccatga

DBGET integrated database retrieval system