KEGG   Streptomyces lavendulae: SLAV_13255Help
Entry
SLAV_13255        CDS       T05314                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni] precursor
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
slx  Streptomyces lavendulae
Brite
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SLAV_13255 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N RTP
Motif
Other DBs
NCBI-ProteinID: ATZ24509
UniProt: A0A2K8PCS0
LinkDB All DBs
Position
complement(3139133..3139528)
Genome map
AA seq 131 aa AA seqDB search
MLSRFFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRARAITIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPQLHTLVNDTLKALSAAKASNDPATGAKALELIAE
IDRIFWETKAA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcttcttcgcccccaaggtgaaggtctccgcccactgcgacctgccctgc
ggtgtgtacgacccggcccaggcccgcatcgaggccgagtccgtcaaggccgtccaggag
aagtaccaggccaacgaggacgccgacttccgcgcccgcgccatcaccatcaaggagcag
cgcgccgagctcgcgaagcaccacgtgtcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccccagctgcacaccctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtcgaacgacccggcgaccggcgcgaaggccctggagctcatcgccgag
atcgaccgcatcttctgggagaccaaggccgcctga

DBGET integrated database retrieval system