KEGG   Streptomyces lavendulae: SLAV_14085Help
Entry
SLAV_14085        CDS       T05314                                 

Gene name
sdhA1
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
slx  Streptomyces lavendulae
Pathway
slx00020  Citrate cycle (TCA cycle)
slx00190  Oxidative phosphorylation
slx00650  Butanoate metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx01130  Biosynthesis of antibiotics
slx01200  Carbon metabolism
Module
slx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLAV_14085 (sdhA1)
   00650 Butanoate metabolism
    SLAV_14085 (sdhA1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SLAV_14085 (sdhA1)
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SLAV_14085 (sdhA1)
    1.3.5.4  fumarate reductase (quinol)
     SLAV_14085 (sdhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like FAD_oxidored GIDA Thi4 FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ATZ24673
UniProt: A0A2K8PG02
LinkDB All DBs
Position
3312289..3314190
Genome map
AA seq 633 aa AA seqDB search
MAQVERQQWDVVVVGAGGAGLRAAIEARERGARTAVICKSLFGKAHTVMAEGGIAASMGN
VNDHDNWQVHFRDTMRGGKFLNQWRMAELHAKEAPDRVWELETWGALFDRTPDGRISQRN
FGGHEYPRLAHVGDRTGLELIRTLQQKIVQLQQEDFKEYGDHEARLKVFQECTVTRVLKD
GARVSGTFCYERESGRFFVLEAPAVVLATGGIGKSFKTTSNSWEYTGDGHALALLAGAPL
LNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGERFMFDYVPDVFKEKYAESE
EEGDRWYEDPDHNRRPPELLPRDEVARAINSEVKAGRGSPHGGVFLDVSTRMPAERIKRR
LPSMYHQFKELADVDITAEPMEVGPTCHYVMGGIAVDSDTAATVGVPGLFAAGEVAGGMH
GSNRLGGNSLSDLLVFGRRAGLHAAGYASEGGARPVVSQEQIDAAAAEALAPFHAAEGAE
NPYTLHQELQTTMNDLVGIIRREAEMAEALERLAALRVRAARAGVEGHRQFNPGWHLALD
LRNMLLVSECVARAALERTESRGGHTREDRPAMEREWRPVNLLCRPVDPPPADPAADRIV
LVRTRTEPIRPDLLALFEKEELAKYLAEEELCE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtggaacggcagcagtgggacgtggtcgtggtcggcgcgggcggcgccggg
ctgcgggccgcgatcgaggcgcgcgagcggggcgcccgtacggccgtgatctgcaagtcc
ctgttcggcaaggcccacacggtgatggcggagggcgggatcgccgcctccatgggcaac
gtcaacgaccacgacaactggcaggtgcacttccgcgacaccatgcgcggcggcaagttc
ctcaaccagtggcggatggccgaactgcacgcgaaggaggcccccgaccgggtctgggag
ctggagacctggggcgcgctcttcgaccgcacgcccgacggcaggatctcccagcgcaac
ttcggcgggcacgagtacccgcgcctggcgcacgtcggcgaccggacggggctggagctg
atccgcaccctccagcagaagatcgtccaactgcagcaggaggacttcaaggagtacggg
gaccacgaggcccggctcaaggtcttccaggagtgcacggtgacgcgggtgctgaaggac
ggcgcccgggtctcggggaccttctgctacgagcgcgagagcggccggttcttcgtcctg
gaggccccggcggtggtcctggccaccggcgggatcggcaagtccttcaagaccacctcc
aactcctgggagtacacgggggacggccacgcgctggccctgctcgccggggccccgctg
ctgaacatggagttcgtgcagttccacccgacgggcatggtctggccgccctcggtgaag
gggatcctcgtcaccgagtccgtgcgcggcgacggcggggtgctgcgcaacagcgagggc
gagcggttcatgttcgactacgtgccggacgtgttcaaggagaagtacgcggagtccgag
gaggagggcgaccgctggtacgaggacccggaccacaaccggcgcccgcccgaactgctg
ccccgcgacgaggtggcgcgggccatcaactccgaggtgaaggcgggccgcggctccccg
cacggcggggtcttcctcgacgtgtcgacccggatgccggccgagaggatcaagcggcgg
ctgccctccatgtaccaccagttcaaggagctggcggacgtggacatcaccgccgagccg
atggaggtcggcccgacctgccactacgtgatgggcgggatcgccgtcgactcggacacc
gccgccaccgtcggcgtgccggggctgttcgcggccggcgaggtggcgggcggcatgcac
ggctcgaaccggctcggcggcaactccctgtccgacctgctggtcttcggccgccgggcg
ggactgcacgcggccggatacgcgtcggagggcggggcgcggccggtggtctcccaggag
cagatcgacgcggcggccgccgaggcgctggcccccttccacgcggcggagggcgcggag
aacccgtacacgctccaccaggagctgcagacgaccatgaacgacctggtcggcatcatc
cgccgggaggccgagatggccgaggccctggagcggctcgccgcgctgcgcgtgcgggcc
gcccgcgccggggtcgaggggcaccggcagttcaaccccggctggcacctggcgctggac
ctgcgcaacatgctgctggtcagcgagtgcgtggcccgcgccgccctggagcgcaccgag
agccggggcgggcacacccgggaggaccgccccgcgatggagcgggagtggcgtccggtc
aacctgctgtgccggccggtggacccccctcccgccgatccggccgccgaccggatcgtc
ctcgtccgtacccggaccgagcccatccgccccgacctgctggccctgttcgagaaggaa
gagctggccaagtacctcgccgaagaggagctctgcgaatga

DBGET integrated database retrieval system