KEGG   Streptomyces lavendulae: SLAV_14090Help
Entry
SLAV_14090        CDS       T05314                                 

Gene name
sdhB1
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slx  Streptomyces lavendulae
Pathway
slx00020  Citrate cycle (TCA cycle)
slx00190  Oxidative phosphorylation
slx00650  Butanoate metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx01130  Biosynthesis of antibiotics
slx01200  Carbon metabolism
Module
slx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLAV_14090 (sdhB1)
   00650 Butanoate metabolism
    SLAV_14090 (sdhB1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SLAV_14090 (sdhB1)
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SLAV_14090 (sdhB1)
    1.3.5.4  fumarate reductase (quinol)
     SLAV_14090 (sdhB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_7 Fer4_18 Fer4_9 DUF1126 Fer4_10
Motif
Other DBs
NCBI-ProteinID: ATZ24674
UniProt: A0A2K8PD58
LinkDB All DBs
Position
3314187..3314969
Genome map
AA seq 260 aa AA seqDB search
MTAYDARFRVWRGDAEGGSLRDFTVEVHDGEVVLDIVHRIQATQASDLAVRWNCKAGKCG
SCSAEVNGRPRLMCMTRMSVFARDETVTITPLRAFPVVRDLVTDVSFNYAKAREVPAFVP
PEGVAAGAYRMQQVDVERSQEFRKCIECFLCQDTCHVVRDHEENKAAFAGPRFLMRVAEL
DMHPLDAAAEAGLDRKRAAQEEHGLGYCNITKCCTEVCPEGIRITDNALIPLKERAVDRK
YDPLVWLGSRIRRRSDSDPR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctacgacgcacgcttccgggtctggcggggtgacgcggagggcggatcgctc
agggacttcaccgtcgaggtgcacgacggtgaggtggtcctggacatcgtccaccggatc
caggcgacgcaggcgtccgacctcgcggtgcgctggaactgcaaggcgggcaagtgcggt
tcgtgcagcgcggaggtcaacgggcgaccccggctgatgtgcatgacgcggatgtccgtc
ttcgcgcgggacgagacggtcacgatcaccccgctgcgcgccttcccggtggtgcgggac
ctggtcacggacgtgtccttcaactacgccaaggcgcgggaggtcccggccttcgtgccg
ccggagggggtcgcggcgggcgcgtaccggatgcagcaggtggacgtggagcgctcgcag
gagttccgcaagtgcatcgagtgcttcctgtgccaggacacctgtcacgtggtgcgcgac
cacgaggagaacaaggcggccttcgccggtccgcgcttcctgatgcgggtcgccgagctg
gacatgcacccgctggacgcggcggcggaggcgggcctggaccgcaagcgcgcggcgcag
gaggagcacgggctgggctactgcaacatcaccaagtgctgtacggaggtctgccccgag
ggcatcaggatcaccgacaacgccctgatcccgctgaaggagcgggccgtggaccgcaag
tacgaccccctggtgtggctggggagcaggatccggcgccgttcggattccgacccccgt
tag

DBGET integrated database retrieval system