KEGG   Streptomyces lavendulae: SLAV_14145Help
Entry
SLAV_14145        CDS       T05314                                 

Definition
(GenBank) Extracellular serine proteinase precursor
Organism
slx  Streptomyces lavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Inhibitor_I9
Motif
Other DBs
NCBI-ProteinID: ATZ24685
UniProt: A0A2K8PGF1
LinkDB All DBs
Position
complement(3329538..3331112)
Genome map
AA seq 524 aa AA seqDB search
MSVMRHTRRKTAGVSAIAVVALVLGAAAALPASAADRGAQGVIENAGAAGSVPGSYIVTL
DDSAARSTADSGKAVAKRYGARIDRTYSAALNGYAVEVSEAQARKLAADPAVKSVVQNRV
FTVDATQPNPPSWGLDRIDQRALPLDQSYTYPDKAGEGVTAYIIDTGVRITHQDLGGRAS
YGYDAIDNDNTAQDGHGHGTHVAGTVAGSTYGVAKKAKIVGVRVLDNNGSGTTAQVVAGI
DWVTRNAVKPAVANMSLGGGADSALDTAVRNSIASGITYGVAAGNESTDASTKSPARVAE
AITVGATTNTDAKASYSNYGSVLDIFAPGSSITSSWGTGDTATNTISGTSMATPHVVGAA
ALYLSQNPASTPAQVRDGLVAAATPNVVTGPGTGSPNRLLNVGAGTTPPNPGTRFENTAD
YAINDNSTVESPITVSGISGNAPATLSVPVDIKHTYVGDLKVDLVAPDGTVYNLRNRTGG
SADDIVQTFTVNASSEVANGVWKLRVADLAGADTGKIDSWALQF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgatgcgtcacacccgccggaagaccgccggcgtcagcgcgatagccgtcgtg
gccctcgtgctcggcgccgccgccgcgttacccgcctcggcggccgaccgcggcgcgcag
ggcgtcatcgagaacgcgggggccgccgggtccgtccccggcagctacatcgtgaccctg
gacgactccgcggcgcgctccaccgccgacagcggcaaggccgtcgccaagcggtacggg
gcgaggatcgaccggacctacagcgccgccctcaacggctacgcggtcgaggtctccgag
gcgcaggccaggaagctcgccgccgacccggccgtcaagtcggtcgtgcagaaccgcgtc
ttcaccgtcgacgccacccagccgaacccgccgtcctggggactggaccgcatcgaccag
cgcgcgctccccctcgaccagagctacacctacccggacaaggccggcgagggggtgacg
gcgtacatcatcgacaccggcgtccggatcacccaccaggacctcggcgggcgcgcctcc
tacggctacgacgccatcgacaacgacaacaccgcccaggacggccacggccacggcacc
cacgtggcgggcaccgtcgcgggcagcacgtacggcgtggcgaagaaggcgaagatcgtc
ggcgtccgcgtgctcgacaacaacggctccggcaccaccgcccaggtcgtcgccggcatc
gactgggtgacccgcaacgcggtcaagcccgccgtggccaacatgtcgctcggcggcggt
gccgactccgcgctcgacaccgccgtgcgcaactcgatcgcctccggcatcacctacggc
gtcgccgcgggcaacgagtcgaccgacgcctccaccaagtccccggcgcgcgtcgccgag
gccatcaccgtcggcgccaccaccaacacggacgccaaggccagttactccaactacggc
agcgtcctggacatcttcgccccgggctcctccatcacctcctcgtggggcaccggcgac
accgccacgaacaccatctcgggcacctcgatggccaccccgcacgtcgtcggcgcggcg
gccctctacctgtcccagaacccggccagcaccccggcgcaggtccgtgacggcctggtc
gcggcggccaccccgaacgtggtgaccggccccggcacgggctccccgaaccgtctgctg
aacgtgggcgccggcaccaccccgccgaacccgggcacccgcttcgagaacaccgccgac
tacgcgatcaacgacaactccaccgtcgagtcgccgatcaccgtcagcgggatctccggc
aacgccccggcgacgctgagcgtgcccgtcgacatcaagcacacgtacgtcggtgacctc
aaggtcgacctcgtcgcccccgacggcacggtctacaacctccgcaaccggaccggcggc
agcgccgacgacatcgtccagaccttcacggtgaacgcctcctccgaggtggccaacggg
gtctggaagctgcgggtcgccgacctcgccggtgcggacaccgggaagatcgactcctgg
gccctgcagttctga

DBGET integrated database retrieval system