KEGG   Streptomyces lavendulae: SLAV_15725Help
Entry
SLAV_15725        CDS       T05314                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
slx  Streptomyces lavendulae
Pathway
slx00473  D-Alanine metabolism
slx01100  Metabolic pathways
slx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SLAV_15725 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SLAV_15725 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slx01011]
    SLAV_15725 (alr)
Enzymes [BR:slx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SLAV_15725 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:slx01011]
 Precursor biosynthesis
  Racemase
   SLAV_15725 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATZ24999
UniProt: A0A2K8PE56
LinkDB All DBs
Position
complement(3656350..3657486)
Genome map
AA seq 378 aa AA seqDB search
MNETPMRVYAEIDLDAVRENVRALRARAPRAQLMAVVKSNAYGHGAVPCARAAQEAGATW
LGTATPEEALALRAAGIEGRVMCWLWTPGGPWREAIEADIDVSVSGMWALDEVREAARAA
GRTARIQLKADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSI
RLQLEAFRDMLAYAEKEGVDPEVRHIANSPATLTLPESHYDLVRTGLAVYGVSPAPELGT
PAQLGLRPAMRLKASLALVKSVPAGHGVSYGHHYVTEAETHLALVPAGYADGLPRCASGR
GPVLVGGKVRRAAGRIAMDQFVVDLGEDLAEPGDEAVVFGDAERGEPTAEDWAQAAHTIA
YEIVTRIGGRVPRVYLGG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagactccgatgcgcgtgtacgccgagatcgatcttgacgcggtacgggagaac
gtgcgcgccctgcgcgcacgggcgccccgggcccagctcatggccgtcgtcaagtcgaac
gcctacgggcacggggccgtcccctgcgcccgtgccgcccaggaggccggcgccacctgg
ctcggtaccgccacccccgaggaggcgctcgccctgcgcgccgccggcatcgaggggcgc
gtcatgtgctggctctggacccccggcggcccctggcgggaggccatcgaggccgacatc
gacgtgtcggtcagcggaatgtgggccctggacgaggtacgggaggccgcccgcgcggcc
ggccgcaccgcccggatccagctcaaggccgacaccggcctcggccgcaacggctgccag
cccgccgactgggcggagctcgtcggcgcggccgtcgccgcgcaggccgaaggaaccgtc
caggtcaccggcgtctggtcgcacttcgcctgcgccgacgagcccggccacccctccatc
cggctccagctcgaagccttccgcgacatgctcgcctacgcggagaaggaaggggtcgac
cccgaggtccggcacatcgccaactcgcccgccaccctcaccctccccgagagccactac
gacctcgtccgcaccggcctggccgtctacggcgtctcgcccgcccccgagctcggcacc
cccgcccagctcggactgcgtcccgccatgcgactcaaggcctcgctcgccctggtcaag
tccgtccccgccgggcacggcgtgagctacggccaccactacgtcaccgaggccgagacg
cacctcgcgctggtccccgccggttacgcggacggcctgccgcgctgcgcctccggccgc
gggccggtgctcgtcggcggcaaggtccgccgggccgcgggccggatcgccatggaccag
ttcgtcgtcgacctcggcgaggacctcgccgagcccggcgacgaggccgtcgttttcggc
gacgcggagcgcggcgaacccaccgccgaggactgggctcaagcggcacacacgatcgcg
tatgagatcgtcacccgtatcggaggtcgggtgccccgggtgtacctgggcggctga

DBGET integrated database retrieval system