KEGG   Streptomyces lavendulae: SLAV_22415Help
Entry
SLAV_22415        CDS       T05314                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slx  Streptomyces lavendulae
Pathway
slx00620  Pyruvate metabolism
slx00680  Methane metabolism
slx01100  Metabolic pathways
slx01120  Microbial metabolism in diverse environments
slx01200  Carbon metabolism
Module
slx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLAV_22415 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SLAV_22415 (ppc)
Enzymes [BR:slx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SLAV_22415 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATZ26298
UniProt: A0A2K8PIJ6
LinkDB All DBs
Position
5025072..5027834
Genome map
AA seq 920 aa AA seqDB search
MSSADQAAQAPATRTSAETANAELRADIRRLGDLLGETLVRQEGQDLLDLVEQVRALTRT
DGEAAAELLGETDLETAAKLVRAFSTYFHLANVTEQVHRGKELRAHRAAEGGLLARTADM
LKDADPEHLRETVRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLEEPVSGAGERRRHDL
RLAENIDLVWQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELQRVGVELP
AGTRPLTFGTWIGGDRDGNPNVTPEVTRDVLILQHEHGITDALELVDFLRGLLSNSIRYT
GATEELLTSLQADLERLPEISPRYKRLNAEEPYRLKATCVRQKLLNTRERLAKGIPHEEG
RDYLGTSELLTDLTLIQTSLREHRGALFADGRMDRTIRTLAAFGLQLATMDVREHADAHH
HALGQLFDRLGEESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGHKTLGVFGAV
KDAFEKFGPEVIESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDEL
RAADVILDEMLADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVA
HRYGVRLRLFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLAR
ENLELTVAATLQASALHTAPRQSDDALARWDAAMDIVSDAAHAAYRELVEDPDLPAYFFA
ATPVDQLADLHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALRE
SGQDAALAEMGERWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFARIEAEHE
LTVREVLRITGGERLLDSNPILQQTFAVRDAYLDPISYLQVSLLARQRAAAARGEEADPL
LARALLLTVNGVAAGLRNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgctgaccaggccgcccaggcccccgccacccgcacctccgcggagaccgcg
aacgccgagctgcgcgcggacatccgccgcctcggcgacctcctgggggagaccctcgta
cgccaggagggccaggacctcctcgacctcgtcgaacaagtacgtgccctgacgcgcacc
gacggcgaagccgctgcggagctgctcggcgagaccgacctggagaccgccgccaagctg
gtgcgcgccttctccacctacttccacctcgccaacgtcaccgagcaggtgcaccgcggc
aaggagctgcgcgcccaccgcgccgccgagggcggtctcctcgcccgcaccgccgacatg
ctcaaggacgccgaccccgagcacctgcgcgagacggtccgcaacctcaacgtccggccg
gtcttcaccgcgcaccccaccgaggccgcccgccgcagcgtcctgaacaagctgcgccgc
atcgccgccctgctggaggagcccgtctccggcgccggcgaacgccgccgccacgacctg
cggctcgccgagaacatcgacctcgtgtggcagaccgacgaactgcgggtcgtgcgcccc
gagcccgccgacgaggcccgcaacgccatctactacctcgacgagctgcacgccggcgcc
gtcggcgacgtcctggaggacctcgccgccgagctccagcgcgtcggcgtcgagctgccc
gccggcacccgcccgctcaccttcggcacctggatcggcggcgaccgcgacggcaacccg
aacgtcacccccgaggtcacccgcgacgtgctgatcctccagcacgagcacggcatcacc
gacgccctcgaactggtcgacttcctgcgcggcctgctgtcgaactccatccgctacacc
ggcgccaccgaagagctcctgacctccctccaggccgacctggagcgcctcccggagatc
agcccccgctacaagcggctgaacgccgaggagccgtaccgcctcaaggccacgtgcgtg
cgccagaagctcctcaacacccgcgagcgcctcgccaagggcatcccccacgaggagggc
cgcgactacctcggcacctccgagctgctcaccgacctcaccctcatccagacctccctg
cgcgaacaccgcggcgcgctcttcgccgacggccgcatggaccgcaccatccgcaccctg
gccgccttcggcctccagctcgccaccatggacgtgcgcgagcacgcggacgcgcaccac
cacgcgctcggccagctcttcgaccgcctgggcgaggagtcctggcgctacgccgacatg
ccgcgcgactaccggcagaagctcctcgccaaggagctgcgctcgcgccgcccgctcgcc
ccgacgcccgccccgctcgacgcggccggccacaagaccctgggcgtcttcggcgcggtc
aaggacgccttcgagaagttcggccccgaggtcatcgagtcgtacatcatctcgatgtgc
cagggcgccgacgacgtcttcgccgccgcggtcctcgcccgcgaggccggactcatcgac
ctgcacgccggctgggccaagatcggcatcgtgccgctcctggagaccaccgacgagctg
cgcgccgccgacgtcatcctcgacgagatgctggccgacccctcctaccgccgtctcgtc
tcgctgcgcggcgacgtccaggaggtcatgctcggctactcggactcctccaagttcggc
ggcatcaccacctcccagtgggagatccaccgcgcccagcgccggctgcgcgacgtcgcg
caccgctacggggtgcgcctgcgcctcttccacggccgcggcggcaccgtcggccgcggc
ggcggcccctcgcacgacgcgatcctcgcccagccctggggcaccctggagggcgagatc
aaggtcaccgagcagggcgaggtcatctccgacaagtacctcgtcccctcgctggcccgc
gagaacctggagctgaccgtcgcggccaccctccaggcctccgccctgcacaccgcgccc
cgccagtccgacgacgccctggcccgctgggacgcggccatggacatcgtctcggacgcc
gcgcacgccgcgtaccgggagctcgtcgaggacccggacctgcccgcgtacttcttcgcg
gccacccccgtcgaccagctcgccgacctgcacctgggctcccgcccctcccgccgcccc
gactcgggcgcgggcctggacgggctgcgggccatcccgtgggtgttcgggtggacccag
tcccggcagatcgtgcccggctggtacggcgtgggctccggcctgaaggccctgcgcgag
tccggccaggacgcggccctcgccgagatgggcgagcgctggcacttcttccgcaacttc
ctctccaacgtcgagatgacgctggccaagacggacctgcggatcgcccgccactacgtc
gacacgctcgtgcccgacgagctcaagcacgtgttcgcccggatcgaggccgagcacgag
ctgaccgtccgcgaggtccttcgcatcaccggcggcgagcggctcctggactccaacccg
atcctccagcagaccttcgccgtccgcgacgcctacctggacccgatctcctacctccag
gtgtccctgctggcccgccagcgcgccgcggccgcccgcggcgaggaggcggacccgctg
ctggcccgcgccctgctgctcaccgtcaacggcgtggcggccggtctgcgcaacaccggc
tga

DBGET integrated database retrieval system