KEGG   Streptomyces lavendulae: SLAV_25615Help
Entry
SLAV_25615        CDS       T05314                                 

Gene name
geoB
Definition
(GenBank) Geranial dehydrogenase
Organism
slx  Streptomyces lavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ATZ26916
UniProt: A0A2K8PJK8
LinkDB All DBs
Position
5743121..5744572
Genome map
AA seq 483 aa AA seqDB search
MTELVEHGHLFIGGEWTEPLGTDTIRVVSPHTEQVIGSVPHASRADVDRAVAVARKAFDE
GPWPRLSLDERIAVVTRIKDAIAVRHEELARSISSQNGSPYSWSVLAQALGAMMVYDSAI
KVAAAYPYEERRQGALGPILVRREPVGVVAAVIPWNVPQFVAAAKLAPALLAGCAVILKP
SPEAPLDSYILADIAREAGLPQGVLSVLPADREVSEYLVGHPGVDKVSFTGSVAAGRRVM
EVASRNLTRVTLELGGKSAAVILPDADPAATVAGIVPAAWMNNGQACVAQTRILAPRSRY
EEYADAFAAAAGALVVGDPLDPATQLGPLVAQRQQQRSLDYIRIGQEEGAKVLTGGGRPA
GLERGWYVEPTLFGDVDNSMRIAREEIFGPVVCLIPYGDEEEAVRVANDSEFGLSGSVWT
ADVEHGVDFARRVRTGTFNVNTFSLDMLGPFGGYKNSGLGREFGPEGLSEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacggacacctgttcatcggcggggaatggaccgagccgctg
ggcaccgacaccatccgcgtcgtctccccccacaccgagcaggtcatcggcagcgtcccg
cacgcctcccgcgccgatgtggaccgggccgtcgccgtcgcgcgcaaggccttcgacgag
ggcccctggccccggctctccctggacgaacggatcgccgtcgtcacccggatcaaggac
gccatcgccgtccggcacgaggaactcgcccgttccatcagctcccagaacggctccccg
tactcctggagcgtcctcgcccaggccctcggcgcgatgatggtctacgactccgccatc
aaggtcgccgccgcatatccctacgaggaacgccgccagggcgcgctcgggccgatcctg
gtgcgccgcgagccggtcggggtcgtcgccgccgtcatcccctggaacgtcccgcagttc
gtggccgccgccaagctcgcaccggcgctgctcgccggctgcgcggtgatcctcaagccg
tcgccggaggccccgctcgactcgtacatcctggccgacatcgcccgggaggccgggctg
ccgcagggcgtgctctccgtcctgcccgccgaccgcgaggtcagcgagtacctggtcggc
caccccggggtcgacaaggtctccttcaccggatccgtcgcggccggccggcgggtcatg
gaggtcgcctcccgcaacctgacccgggtcaccctcgaactcggcggcaagtccgccgcc
gtgatcctgcccgacgccgacccggccgccaccgtcgccgggatcgtgcccgccgcctgg
atgaacaacgggcaggcctgcgtggcccagacccgcatcctcgccccgcgcagccgctac
gaggagtacgccgacgccttcgcggcggccgccggggccctcgtcgtgggcgacccgctg
gacccggcgacccagctcggcccgctcgtcgcgcagcgccagcagcagcggtccctggac
tacatccggatcggccaggaggagggcgcgaaggtcctcaccggcggcggccgcccggcc
ggcctggagcgcggttggtacgtcgagcccaccctcttcggcgacgtcgacaactcgatg
cggatcgcccgcgaggagatcttcggcccggtcgtctgcctgatcccgtacggggacgag
gaggaggccgtacgggtggccaacgactcggagttcggcctcagcggcagcgtctggacc
gccgacgtcgagcacggcgtcgacttcgcgcgccgggtgcgcacgggcaccttcaacgtg
aacaccttcagcctggacatgctgggcccgttcggcggctacaagaacagcggcctgggg
cgggagttcgggccggaggggctgagcgagtacctggagcacaagatgatccacctcccg
gccggtgcgtga

DBGET integrated database retrieval system