KEGG   Solanum lycopersicum (tomato): 101244886Help
Entry
101244886         CDS       T02665                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101244886
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sly02000]
    101244886
Enzymes [BR:sly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101244886
Transporters [BR:sly02000]
 Other Transporters
  Pores ion channels [TC:1]
   101244886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_2 GST_C GST_N_3 GST_N_2 GST_C_5 GST_C_6 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 101244886
NCBI-ProteinID: XP_004243195
UniProt: K4CGH7
LinkDB All DBs
Position
7
AA seq 222 aa AA seqDB search
MANDELILLDFWASMFGMRLRIALAEKGIKYEYKEEEGLISNKSALLLEMNPIHKKVPVL
IHNGKPICESIIGVEYIEEVWKDKAPLLPSDPYERAQARFWVDYIDKKLYVSARKIWGTK
GEEQEAGKKDFIEVLKVLEGELGEKPYFGGDNFGFVDIALIGFYSWFYAYETYGNFSAEA
ECPKFVAWAKRCMQRDSVAKSLPDQHKVLEFIQMLRRKFGIE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgatgagttgattttgttggatttctgggctagcatgtttggtatgaggcta
aggattgcccttgctgaaaaagggattaaatatgagtacaaagaagaagagggactgatc
agtaacaaaagtgctctgcttttagagatgaatcctatacacaagaaagttcctgttttg
attcataacgggaaaccaatttgtgagtctattattggagttgagtatattgaagaagtg
tggaaggataaagcccctttgctcccttctgatccttatgagagggcacaagctaggttt
tgggttgattacattgacaagaagttgtatgtttctgcaagaaagatatggggaacaaag
ggagaagagcaggaggcaggtaagaaagatttcatagaagtacttaaagtgttggaggga
gaacttggagagaagccttattttggaggagataattttggttttgtggatattgctttg
attgggttctatagctggttttatgcttatgagacttatggtaacttcagcgcagaggct
gagtgtccaaagtttgtggcttgggctaagaggtgcatgcaaagggacagtgtggccaag
tctttgcctgaccaacataaggtccttgagtttatacaaatgctaaggcggaagtttgga
attgaataa

DBGET integrated database retrieval system