KEGG   Solanum lycopersicum (tomato): 101248407Help
Entry
101248407         CDS       T02665                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00620  Pyruvate metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01200  Carbon metabolism
Module
sly_M00168  CAM (Crassulacean acid metabolism), dark
sly_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
sly_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sly_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101248407
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101248407
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101248407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 101248407
NCBI-ProteinID: XP_004243288
UniProt: K4CG46
LinkDB All DBs
Position
7
AA seq 964 aa AA seqDB search
MSRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCY
ELSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKL
KKRDFSDEASALTESDIEETFKKLVGQLNKSPQEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRDCMTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRAEELHRTSKRDAKHYIEFWKKIPP
NEPYRVLLADVRDRLYNTQERARQLLANGYSDVPEESTFTNLEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDVITRHVGVGSYKEWSEEKRQ
EWLLSELSGKRPLFGPDLPKTDEVADVLDTFHVISELPADSFGAYIISMATAPSDVLAVE
LLQRECHVKSPLRVVPLFEKLADLESAPASVARLFSIDWYRNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVAPNPEWRALLDEMSVVATKE
YRSLVFQDPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHVIEKDIRNLQMLKDMYNGWPFFRVTLDLLEMVFAKGDPGIAALYDKL
LVSEDLWPLGERLRSKYEETKGFLLQVAGHKDLLEGDPYLRQRLKLRDSYITTLNVSQAY
TLKRIRDPNYNVKVRPHLDKEIMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggaaaattgagaaaatggcttcaattgatgcccaattgaggctattggcacca
gcgaaagtgtcagaggatgataagcttgtggagtatgatgctttgttgcttgacagattt
cttgatattctgcaggatttgcatggagaggatattcgagaaacggttcaagattgttat
gaactatctgctgaatatgaagggaaacatgacccacataagttggaagagcttgggagt
atgcttaccagtttggatgctggggattccattgtagtcaccaaagccttttctaacatg
cttaacttgggtaaccttgctgaagaggttcagatagcttacagacgaagaagtaagcta
aaaaagcgtgatttttcggatgaggcttctgcactaactgaatcagacattgaagagact
tttaagaagctcgtcggacagctaaacaaatcaccccaagaagtttttgatgctttgaag
aaccagaccgtggacttggtgctaacagcacatcctacccagtctgttcgtaggtctttg
cttcaaaagcatgcaaggattcgtgattgtatgacgcagttgtacgccaaagatattact
cctgatgataagcaggagctagacgaggctctacaaagagagatacaagcagcctttcgc
acagatgaaatcaggaggactccaccaactccacaagatgagatgagggcggggatgagt
tacttccatgagacaatatggaagggagtgccgaaattcctacgccgtgttgacactgct
ttgaagaatattggaataaatgaacgtgttccctacaatgcccctctcattcagttctct
tcttggatgggtggtgatcgagatggcaaccctagagtaaccccggaagtgacaagagat
gtgtgcttattggctagaatgatggctgcaaatctgtatttctctcagattgaggatctt
atgtttgagctttcaatgtggcgatgcaatgatgagctccgtgtccgtgcagaagaactt
cataggacttccaaaagagatgcaaagcactacattgaattttggaagaaaattccaccg
aatgagccctaccgtgttcttcttgctgatgtgagagataggttatataatacacaggaa
cgagctcgtcagttactagccaatgggtattctgatgttcctgaggagtcgacattcaca
aatcttgaacagtttctggaacctctggagctgtgctatagatctctatgcgcttgtggt
gacagaccaattgcagatggaagccttcttgattttttaaggcaagtgtccacctttggt
ctgtcgcttgtgagacttgatattcggcaagagtcagatagacacactgatgttctagat
gttataacaaggcacgtgggtgttggctcctataaagaatggtctgaagagaagagacag
gaatggctcttatctgaactaagtggcaagcgtccactttttggacctgatctccctaaa
actgatgaagtcgctgatgttttggatacctttcatgtcatctccgaacttcccgccgac
agtttcggtgcttatataatttcgatggccacggcaccctctgatgtgcttgctgttgag
cttttgcagcgtgaatgtcatgtaaaaagtccattgagggttgttccgttgtttgaaaag
cttgctgatctcgagtctgcacctgcttctgttgctcggttgttctccatagattggtac
agaaaccgtatcaatgggaaacaagaagttatgattgggtattctgattccggtaaggat
gctggccgactatctgcagcttggcaattgtacaaggctcaagaggaacttgtaaaggtg
gcaaaagaatttggagtaaagctaacaatgttccatggccgaggtgggactgtaggaagg
ggagggggtcccacccaccttgctattttatcacaacccccagacacaattcatggctca
cttcgtgtgactgttcaaggtgaagttattgaacagtcatttggggaggaacacctgtgc
tttagaactcttcagcgtttcacagcagctacacttgagcatggaatgaacccccctgtg
gctcctaatccagagtggcgtgccctcttggatgagatgtctgttgttgctacgaaagag
tatcggtctttagtgttccaggatccacgatttgttgaatacttccgccttgcaacccca
gaattagaatatggtcgcatgaacattggaagtcgcccagccaaaaggaagccaagtggt
gggattgaatctcttcgagctattccatggatctttgcatggactcagacaaggtttcat
ctcccagtctggcttggctttggggctgcattcaagcacgttattgagaaggatataaga
aatctgcaaatgctcaaggatatgtacaatggatggcctttctttagagtgacacttgac
ttgctcgaaatggtcttcgctaagggagaccctggtattgctgcattgtatgataaactt
ttagtatccgaagatctgtggccgcttggagagcgattgagatccaaatacgaagaaaca
aagggctttctccttcaggttgctgggcacaaggatctattggaaggagatccatacttg
aggcaaaggctcaaacttcgtgattcttacatcacgacccttaacgtaagccaagcatac
acattgaaacgaattcgtgaccccaactacaatgtgaaggtcagacctcacctagacaag
gagatcatggaatcaagcaaaccagctgctgaattagtgaagctgaatcctacgagcgag
tatgcgcctggcttggaagacaccctcatcttgaccatgaaaggtattgctgctggaatg
cagaacactggttaa

DBGET integrated database retrieval system