KEGG   Solanum lycopersicum (tomato): 101249429Help
Entry
101249429         CDS       T02665                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03030  DNA replication
sly03410  Base excision repair
sly03420  Nucleotide excision repair
sly03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101249429
   03410 Base excision repair
    101249429
   03420 Nucleotide excision repair
    101249429
   03430 Mismatch repair
    101249429
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sly03032]
    101249429
   03400 DNA repair and recombination proteins [BR:sly03400]
    101249429
Enzymes [BR:sly01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101249429
    6.5.1.6  DNA ligase (ATP or NAD+)
     101249429
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101249429
DNA replication proteins [BR:sly03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101249429
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101249429
DNA repair and recombination proteins [BR:sly03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101249429
   NER (nucleotide excision repair)
    Other NER factors
     101249429
   MMR (mismatch excision repair)
    Other MMR factors
     101249429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 101249429
NCBI-ProteinID: XP_004233623
UniProt: A0A3Q7FC62
LinkDB All DBs
Position
2
AA seq 1441 aa AA seqDB search
MSADAGTLTLDSTTLYITALNSLSDKSSSNSIPLSLPLPPIPSSIPQPKLIPRTRFIIDG
FKYAADFSVSYFLSHFHSDHYTGLSSNWSKGIIFCSSITANLLIEVLNVPAQYVVSLPLS
EAVLIDGSEVLLIDANHCPGAVQFLFKVPVSDGKFERYVHTGDFRYCDDMKLEPVLNAFV
GADAVFLDTTYCHPKFIFPSQQESIDYIVGVIEKSGVENEGSLKNILFLIATYVIGKEKI
LMEVSRRCQRKIHVDGRKMSVLGVLGHGEDGVFTTVESETDVHVVGWNVLGETWPYFRPN
FEKMDKIMNEKGYSKVVSFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELREY
VKFLKPKHVIPTVGTDVEKLDSKHADAMRKHFAGLVDQMAIKQEFLMHFHPSVQGKEDVD
TKESGLALVRITEEENTNRSTHTPVSIIKQENEDTSSDSKSCNAADMDTVIPSSFPQGES
VSPGLEKISEGDMEEILEELQGCLPTWVTRGQMLDLVSISHKNVVDAVSYFYEHETEYRE
QVTASNSVTSSLEANSANKSALPCKPCLGKSLQQDETAASSKTVKLPNTDSSCSKKVSPG
KRKRSTGNKSSSSSNKVSPGIRKRSTGNKSFEKAKGHTSMESGGPKQCTITKFFSKTLPL
PLQNQNSEAGSKNFHDDSCMLPNASIEAYKEEADRFIQIMNGDDSLRSYATTVLAKTKGD
ISMALDIYFSEYKDVGETNGDGISKTNKLLQPQCAKEVYTSSKDDKLPKILGDVDPNLSL
CGVPFADNAVNYVSLPHEEYSPVEHACWSKGQATPYIHLARTFELVKEEKGKIKATSMLC
NMFRSLLALSPEDVLPAVYLCTNKIAPDHENMELNIGGSTVVAALEEACGTKKSKVRELY
NSLGDLGDVAQLCRQTQSLLAPPVALTIRGVYSALRRISLQAGSGSAIRKKSLIVNLMCS
CREKEMKFLVRTLVRNLRIGAMMRTVLPALAQAVVFNSTPYEGLVENLKDCLQRLSAEVV
EAYNILPSLDVLVPSLMEKGIEFSSNTLSMAPGIPIKPMLAKITNGVPQVMKLFQNKAFT
CEYKYDGQRAQIHKLSDGSVRVFSRNGDETTSRFPDLVNIITESCDSRGATFILDAEVVA
IDRQNGPKLMSFQELSSRERGSKDSIIALDKIKVEICIFVFDIMFANGEQLLNLPLRQRR
KYLKDLFGDGKVGYLEYATEMTVECDDACADDEATLARMNSFLNDALHASCEGIMVKSLD
EDAGYTPSKRSDAWLKVKRDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPDTE
EFQSVCRVMSGFSDSFYVEMRDFFDADKICQKKPPYYRSEEVPDMWFSPEVVWVIRGADF
TVSPVHHAAIGLVHPSRGISVRFPRFIRCLSDRKPEECSTSADIADMFRTQIRKMDVKVE
K
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgacgccggaaccctaaccctagactcaaccactctgtacataaccgctctc
aactccctctctgataaatcctcatcaaattcaatcccattgtcccttcctctccctcca
atcccttcttctatcccccaaccaaaactcatcccaagaactcgctttatcatcgacggt
ttcaaatatgccgctgatttctccgtttcttacttcctctcccattttcactccgatcac
tatactggcctctcctctaattggtctaaaggtatcatattctgttcctccatcactgct
aaccttctcatcgaagttctcaatgttcccgcgcaatatgtagtatctttaccgctctcc
gaagcggttctaatagacggttctgaagttcttctcatcgatgccaatcattgtcccggt
gctgtgcagttcttatttaaagttccagttagtgatggaaaatttgagcggtacgttcac
acaggtgattttcgttattgtgatgacatgaaattagagcctgtattgaatgcatttgtg
ggtgctgatgctgtatttttggatacaacttattgtcatccgaaatttatattccctagt
caacaggagtcaattgattatatagttggagttatagagaaaagtggagttgagaatgag
ggttcattgaaaaatatcttgtttcttattgctacttatgtcattgggaaagagaagatt
ttaatggaggtttcacggaggtgtcagagaaagatccatgttgatggacgaaaaatgtcg
gttttaggagtattaggtcatggggaggatggagtatttactaccgttgagtctgaaact
gatgttcatgttgttgggtggaatgtattgggtgagacttggccatatttcaggcctaat
tttgagaaaatggataagatcatgaatgagaaaggatattccaaggtggttagttttgtc
cccacaggttggacttatgaagtgaagcggaataagttttcagtgagaaagaaagattcc
tttgagatacatcttgttccatatagtgaacattcaaattatgatgagcttagagaatat
gtgaaatttttgaaaccaaagcatgtcatcccaacagtaggtacagatgttgagaagctg
gatagcaaacatgcagatgccatgcggaagcattttgctggcttggttgatcagatggcc
atcaagcaagaatttctaatgcattttcatccttctgtccaagggaaggaagatgtagat
acaaaagaatctggtcttgctttagttagaattacggaggaagaaaacacaaacagatct
actcatactccagtcagtatcatcaaacaagaaaatgaggatacttcatctgattctaaa
agctgcaatgctgctgatatggatactgttatcccttcctcatttcctcaaggagaatct
gtgtcgccaggtttagaaaaaataagtgaaggtgatatggaggaaatactagaagaactt
caaggctgtttgcccacttgggtaactagaggtcagatgttggatttagttagtatttca
cataaaaatgttgttgatgcagtctcatacttttacgaacatgaaacagaatatcgtgaa
caggtcactgccagtaattctgttacctcttctttagaggcaaactcagcaaataagtct
gcattgccttgtaaaccatgtcttggtaaaagcctgcagcaagatgagacagctgcgtca
agtaaaactgttaaactacccaacacggacagttcctgtagcaaaaaagtttctcctggt
aaaaggaagagaagtactggaaacaagtccagttccagtagcaacaaagtttctcctggt
ataaggaagagaagtactggaaacaagtcatttgaaaaagcaaaaggacatacgagtatg
gaatctggtggaccaaagcaatgtactataacaaagttcttcagtaaaacgctgcctctt
cctttgcagaatcaaaacagtgaagccggtagtaaaaatttccatgatgatagttgcatg
ctaccaaatgcctctatagaggcttataaagaggaggctgatcggtttattcagattatg
aatggggatgactcattgagaagttatgctaccacagtactagcgaagactaaaggagac
ataagtatggcacttgatatttatttttcagaatacaaagatgtaggagagactaatgga
gatgggatttctaaaacaaacaaattgttgcaacctcagtgtgctaaagaggtttacact
tcttccaaagatgataaattacccaaaatattaggagatgttgatcccaatttgtcgttg
tgtggtgttccctttgctgataatgctgtaaattatgtatcacttccccatgaggaatac
tctcccgtggaacatgcttgctggagtaaggggcaggctactccatacatacatcttgca
cgaacttttgaattggtaaaggaagaaaaagggaagataaaagcaacgtcaatgttgtgc
aatatgtttcggagcttgctagctttgtctccggaggatgtgcttcctgctgtgtacttg
tgcacaaacaagatagcccctgaccatgaaaatatggaattgaacattgggggtagtact
gttgtagcagcactagaggaggcatgcgggacaaagaaatcaaaagtacgagaactatac
aacagcctcggtgatcttggtgatgttgctcaactttgccgacaaacacaatcattactt
gctcctccagtggcacttacaattaggggtgtatactctgctcttagaaggataagcttg
caagcaggtagtgggagcgccatccgaaagaaaagcctgattgtcaatctcatgtgttca
tgtagagagaaggagatgaagtttcttgtgagaacgttggttcggaatttgcgcattgga
gccatgatgagaactgttcttcctgcattagctcaagcagttgtgttcaattctactcct
tatgagggactggtcgaaaacctgaaagattgtctgcagcgactttcagcagaagtagta
gaagcatataacatccttcccagcttggatgtacttgttccttccttgatggagaagggg
attgagttttcctcaaatacattgtcaatggctccaggcatacccatcaaaccaatgctt
gcaaagattactaatggggtccctcaagtgatgaagctctttcagaacaaagcctttaca
tgtgaatacaaatatgatggtcagcgagctcagattcataaactgtctgatggttcagtc
cgtgtattttcaaggaatggggatgagacaacatctagatttccggatttggtaaatatt
attacagaatcatgtgattccagaggagcaacatttatcttggatgcagaggttgttgca
attgataggcaaaatggtccaaagctcatgtcgttccaagaactatcttcacgtgagagg
gggtccaaagattccatcattgcgttagataaaattaaggttgagatatgcatttttgtt
ttcgatatcatgtttgcaaacggagaacaattgttgaatctgccgctccgtcaaaggcga
aaatatttgaaggatttatttggtgatggcaaagtaggttatttagagtacgcgacagaa
atgactgtagagtgcgatgatgcttgtgcagatgatgaagctacactggctaggatgaac
agctttcttaatgatgcactacatgcttcatgtgaagggatcatggtgaagtcccttgat
gaagatgctgggtacacaccctcaaagcgctctgatgcatggttaaaggtcaagagagac
tatgttgaaggattaaatgattccctggacttggttccaattggtgcatggcatgggaat
ggaagaaaagcaggatggtatagtcctttccttatggcctgctacaaccctgacacggag
gaatttcagagtgtctgccgggtcatgtctgggttttctgattccttctatgtagagatg
agagacttcttcgatgcggacaagatctgccagaaaaagccaccctactaccgaagtgaa
gaggttccggatatgtggttttctccagaagttgtgtgggtgataaggggtgctgacttc
acagtgtcaccagtgcatcacgcagctattggtttagtccatccatctcgtggtatttct
gtcagatttcccaggttcatccggtgtttgtcagatagaaaacctgaggaatgtagcaca
tctgcagatatagctgacatgttccgcactcagattagaaaaatggatgtgaaggttgaa
aaatag

DBGET integrated database retrieval system