KEGG   Solanum lycopersicum (tomato): 101252563Help
Entry
101252563         CDS       T02665                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sly01001]
    101252563
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101252563
Protein kinases [BR:sly01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101252563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101252563
NCBI-ProteinID: XP_004235219
UniProt: A0A3Q7FPA7
LinkDB All DBs
Position
3
AA seq 463 aa AA seqDB search
MVSATQPTGKPFNNHMLLPLQHPKVVSLDDVDMDFSDIFGPAPAQVLSSENVAMSETNGF
IYEEPAVIYSRSHSFVGPTNYVSQLLKLSKLKLRESEHLLELVEGDSGETNDHLEEATSD
SAVTDKSDVHADANTPRSVGLNDFEVLKVVGQGAFGKVYQVRKIGTSEILAMKVMRKDKI
LEKDHAEYTNTERDVLTKIDHPFVVQLRYSFQTKYRLYLVLDFVNGGHLFFQLRRQGLFR
EDLARIYTAEIVSAVSHLHSNGIMHRDLKPENILLDADGHVVLTDFGLAKQFDENTRSNS
LCGTIEYMAPEIVLGKGHDKAADWWSVGVLLYEMLTGKPPFVGNRQKVQQKIIKDKIKLP
AFLSSDAHSLLKGLLHKDASKRLGCGSIGSDEIKSHKWFKSIYWKKLDAREIQPSFCPQV
SGKLCIANFEEQWTSMPLLDSPAASPKSGDNPFKGFSYVRPAE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgctacacaaccaactgggaagcctttcaacaaccacatgctgctcccattg
caacaccccaaagttgtatcacttgatgatgttgatatggatttctcggacatatttggt
cctgctccagctcaagttttgagctctgagaatgttgcaatgtcggaaacaaatggattt
atatatgaagaaccagctgtaatttatagccgttctcattcctttgttggtccgacaaac
tatgtcagtcaattgttgaagcttagcaaactcaaacttcgtgagagtgaacacttgtta
gagcttgtggagggtgatagtggagagaccaatgatcatcttgaagaagctacttccgat
tctgctgttactgataaaagtgatgttcatgctgatgctaataccccaaggtctgtggga
cttaacgatttcgaagtcttaaaggttgttggacaaggtgcatttggaaaagtatatcag
gtgaggaagattgggacttctgaaattcttgcaatgaaggttatgcggaaagataagatt
ttggagaaagatcacgctgagtatacgaatacagagagggatgtattgacaaaaatagat
catccatttgttgtgcagctcagatactctttccagaccaaatacagactataccttgtg
cttgactttgttaacggaggacaccttttctttcaactccgtaggcaaggcttattcagg
gaggatttggcacgcatctacactgctgagattgtttctgctgtttctcacctccattct
aatggcataatgcacagggatctaaagccagaaaatattcttttggatgctgatgggcac
gtagtgctgactgattttggccttgctaagcaatttgatgagaacacgagatccaactct
ttgtgtggaactattgaatatatggcacctgaaattgttcttggaaaaggtcatgataag
gctgcagactggtggagcgtgggagttcttttgtatgagatgctgacaggaaagcctcca
tttgttgggaaccgacagaaagttcaacaaaagatcataaaagacaagattaagctgcca
gcatttttgtctagtgatgcacattcattgttgaaagggctgctacacaaggatgcaagc
aagcgccttggctgtggatcaataggtagtgatgagataaaaagtcacaaatggttcaag
tctatctattggaagaagttagatgctcgagaaattcaaccaagtttctgtccccaagtt
tcagggaagctgtgtattgccaattttgaagagcaatggaccagcatgcctttgctagat
tctcctgctgctagtccaaaatctggtgataatcccttcaagggtttcagttatgtgcgg
ccagcagaataa

DBGET integrated database retrieval system