KEGG   Solanum lycopersicum (tomato): 101253286
Entry
101253286         CDS       T02665                                 

Definition
(RefSeq) vinorine synthase
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00940  Phenylpropanoid biosynthesis
sly00941  Flavonoid biosynthesis
sly00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    101253286
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    101253286
   00941 Flavonoid biosynthesis
    101253286
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     101253286
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 101253286
NCBI-ProteinID: XP_004239499
LinkDB
Position
5
AA seq 434 aa
METMKIEIEIISKLVIKPSTPTPHELHNYKLSYLDQITPNILMPLVFFYQANNNFTKTHI
SNQLKTSLSHTLTKFYPLCGRLDVANTHVNCNDEGVPYVEAIAKCNLSDFLLDPLPNELN
KLIPCDLHDVKEFCLLVQANFFQCGGMAIGIAISHKIADALSTFMIINTWGAIARGSIDI
PCPRFDSSILFPPRDVTKFKSSVMIEKDNIVTKRFVFSASKVSALRDKYTEKGTENTRPP
SRIEALSAFIWTRLMASIHAERDETKIYGMVHTVNLRTRSDPPLPDSLFGNVMQVVVTVP
ATDSNDNNSTNKEQDFELVKKVRESINNVNSEFVSGLRKKDQKHLSFIKEKANEQRKGEL
VVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDVIGFLDTKSGNGIEAWVNLREEDMA
IFEADKELLSWCSD
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggaaactatgaaaattgaaatagaaatcatctccaaattggtaatcaaaccatctaca
ccaaccccacatgaacttcacaattacaaactttcatatcttgatcaaattactccaaat
attttgatgccacttgtttttttctatcaagcaaacaataacttcaccaaaacacacata
tcaaaccaactcaagacatctttatcacataccttgacaaaattctaccctctttgtgga
cgtctagacgtagccaacacccacgtcaactgcaacgatgagggtgttccatatgtagaa
gccatagccaaatgcaatctctcagacttccttcttgatccacttcctaacgaacttaac
aagctcatcccttgtgatttacatgatgttaaagagttttgcttactagtacaagcaaac
ttttttcaatgtggaggaatggctattggtatagccatttctcataagatagctgatgca
ttgtccacgttcatgattattaatacctggggagctattgcaagagggagtatcgacata
ccttgtccaagatttgattcttccatactatttccaccaagagatgtaacaaagttcaaa
tcaagcgtcatgattgagaaagacaacattgtgactaagaggtttgtgttctctgcctct
aaagtatcagcactcagagataagtatactgaaaagggcactgaaaatactagacctccc
tcgaggattgaagctttatcagctttcatatggacacgtttgatggcaagtattcatgct
gaaagagatgaaactaagatatatggcatggttcatacggtgaacttacgtaccagaagt
gatcctccattgcctgattccttattcgggaatgtaatgcaagtagtcgttacagtacca
gctacagatagtaatgataataatagtactaataaggaacaagattttgagctagtaaaa
aaagtaagagaaagtataaacaacgtaaacagtgaatttgtctcaggtctccggaagaag
gatcaaaaacacttgagtttcatcaaagagaaagcaaatgagcagaggaaaggggagcta
gtcgtgttcaacttcactagtttgtgtcgattgcctttatacaaagctgattttggttgg
ggaaaaccgatatgggtaggatcggctagacttgttctcaaggatgttattggtttccta
gacacaaagtcaggtaatggcatagaagcctgggtaaatctcagagaagaagacatggct
atatttgaagctgacaaggaattgctttcttggtgtagtgactga

DBGET integrated database retrieval system