KEGG   Solanum lycopersicum (tomato): 101253771Help
Entry
101253771         CDS       T02665                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00030  Pentose phosphate pathway
sly00051  Fructose and mannose metabolism
sly00052  Galactose metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
sly01230  Biosynthesis of amino acids
sly03018  RNA degradation
Module
sly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101253771
   00030 Pentose phosphate pathway
    101253771
   00051 Fructose and mannose metabolism
    101253771
   00052 Galactose metabolism
    101253771
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101253771
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sly01009]
    101253771
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sly03019]
    101253771
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101253771
Protein phosphatases and associated proteins [BR:sly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101253771
Messenger RNA biogenesis [BR:sly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101253771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Trm56
Motif
Other DBs
NCBI-GeneID: 101253771
NCBI-ProteinID: XP_004236642
UniProt: A0A3Q7FY36
LinkDB All DBs
Position
4
AA seq 456 aa AA seqDB search
MSNSSPSISISNVQLQHISHLTNYNSQIKTHTNPLAVNPFFRTFPGFFLTSSDIVLRHNV
LDLSGTFPSPNPPLAYHRAGPRNQILFDPVTVRAAIVTCGGLCPGMNTVIRELVVGLWEL
YGVREIFGIKAGYRGFYSYDPVRLNPKMVDDWHKRGGTVLETSRGGFDLKKIVDAIQDHG
FNQLYIIGGDGTMRGAVEIFEELKQRKLYISVVGIPKTVDNDVGIIDRSFGFQTAVEMAQ
QAINAAHVEAESAVNGIGLVKLMGRSTGHIALHATLSSRDVDCCLIPEIDFYLEGKGGLF
EFLEDRLKEMGHAVLVVAEGAGQDIIPRTESQKTEKDESGNPVFLDVGGWLKSELKNWWS
RDHPNELFTIKYIDPTYMIRAVPPNATDNSYCTLLAHSAIHGVMAGYTGFVCGPINGNYA
YIPVDEVAKAKNKVDTRDHKWSWVRSVSNQPDFIRS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcatctccttcaatttccatctcgaatgttcagctacaacacatatcgcat
ctcacaaactacaattcccaaatcaaaacccacactaacccacttgccgttaaccccttt
ttccgtactttccccggattcttccttacctcatccgatatcgttctccgtcacaatgtt
ctagatctctctggaactttcccttcacctaatccgccattagcttaccacagagcagga
cctcggaatcagattctcttcgatcctgttactgtacgagctgcgattgttacctgtggg
ggtttgtgccctgggatgaatacggtgattcgggaattggtggttgggttgtgggaattg
tacggcgttcgtgagatttttgggattaaagcgggttatcgagggttttatagctatgac
ccggtacgattgaatccgaagatggttgatgattggcataagagaggtggaactgtgctt
gagacttctagaggtggatttgatttgaagaagattgttgatgctatacaggatcatggg
tttaaccagctttacatcataggaggagacggtacaatgcgtggagcagttgagatattc
gaggaattgaaacaacgaaaattgtatatatcagtggttggaatccctaagacagttgac
aatgatgtaggcattatcgacagatcatttgggttccaaactgcagttgagatggcacaa
caagctattaatgccgctcatgtagaagcggagagtgcagtaaatgggatagggttggtg
aagcttatgggtcgcagtactggtcatattgcactacatgcaacattaagtagccgtgat
gtcgattgttgtttgattcccgagatcgacttctacttggaaggtaagggagggctattt
gaatttctcgaagaccggttgaaggagatggggcacgcggtgctggtagtagccgagggt
gcaggacaagatataataccgaggactgaatcccagaaaacagagaaggacgagtcgggc
aacccagtcttcttggacgttggagggtggctgaagtccgaactcaagaattggtggagc
agggatcatccaaacgagttgttcacgataaaatacatagatcctacgtacatgatacgt
gctgttcctccaaacgcaacagataactcgtactgcacgttgttggcgcactctgccatt
cacggagttatggcagggtacaccgggttcgtttgtggaccgataaatgggaactatgca
tatattccagttgatgaagttgccaaagcaaagaacaaagtcgatactagagatcataaa
tggtcttgggttagatctgttagcaatcagcctgatttcatcagaagttga

DBGET integrated database retrieval system