KEGG   Solanum lycopersicum (tomato): 101254485Help
Entry
101254485         CDS       T02665                                 

Gene name
SlADH2B7d
Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7d
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00053  Ascorbate and aldarate metabolism
sly00071  Fatty acid degradation
sly00280  Valine, leucine and isoleucine degradation
sly00310  Lysine degradation
sly00330  Arginine and proline metabolism
sly00340  Histidine metabolism
sly00380  Tryptophan metabolism
sly00410  beta-Alanine metabolism
sly00561  Glycerolipid metabolism
sly00620  Pyruvate metabolism
sly00903  Limonene and pinene degradation
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101254485 (SlADH2B7d)
   00053 Ascorbate and aldarate metabolism
    101254485 (SlADH2B7d)
   00620 Pyruvate metabolism
    101254485 (SlADH2B7d)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101254485 (SlADH2B7d)
   00561 Glycerolipid metabolism
    101254485 (SlADH2B7d)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101254485 (SlADH2B7d)
   00310 Lysine degradation
    101254485 (SlADH2B7d)
   00330 Arginine and proline metabolism
    101254485 (SlADH2B7d)
   00340 Histidine metabolism
    101254485 (SlADH2B7d)
   00380 Tryptophan metabolism
    101254485 (SlADH2B7d)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101254485 (SlADH2B7d)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101254485 (SlADH2B7d)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101254485 (SlADH2B7d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101254485
NCBI-ProteinID: NP_001333533
UniProt: A0A3Q7H4T5
LinkDB All DBs
Position
5
AA seq 529 aa AA seqDB search
MAARVFLSRSVHLLSKGKRSHLGKIAAYKYSTAAAFEEPVKPTVNVDHTKLLINGQFVDS
ASGKTFPTLDPRTGEVIAHIAEGDAEDINRAVAAARKAFDEGPWPRMTAYERSKILLRLA
DLIEKHNDQIATLETWDTGKPYAQAAKIEVPMVVRLLRYYAGWADKIHGMTIPADGPYHV
QTLHEPIGVAGQIIPWNFPLLMFSWKIGPALACGNTIVLKTAEQTPLSALYVASLFQEAG
LPEGVLNIISGYGATAGASLCSHMDVDKLAFTGSTETGKTILELAAKSNLKPVTLELGGK
SPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRVVG
DPFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKGYYIRPTVFSNVKDD
MLIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDTANTLARALRVGTVW
INCFDTFDATIPFGGYKMSGQGREKGEYGLKNYLQVKAVVTPLKNPAWL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtgtatttctctctcgttctgttcatctgctatcaaagggaaaaagatcc
catcttggcaaaatagctgcttataaatacagcacagcggctgctttcgaggagcccgtc
aagcctactgtcaatgtggatcatactaaacttcttatcaacgggcaatttgttgattct
gcatcaggaaaaactttcccgactctcgaccccaggacaggggaggtaattgcacatatt
gctgaaggtgatgcagaagatattaatcgggcagttgctgctgctcgtaaggctttcgat
gaaggaccatggcctaggatgactgcttatgaaaggtcaaagatattgctgcgccttgct
gatctgattgaaaaacataacgatcaaattgcaacgctcgagacttgggacactgggaag
ccttatgcacaagctgctaagattgaagtaccaatggttgtacgtctactccgttattat
gctggctgggcagataaaattcatggtatgaccattcctgccgatggaccatatcatgtt
caaacgttgcatgaaccgatcggggttgctggtcagattatcccatggaattttcctctt
ctcatgttttcttggaagattggccctgctttagcttgtggtaacacaattgtgctaaag
acggctgagcagaccccattatctgcattgtatgtagcaagtctatttcaggaggctggc
ctgcctgaaggtgttctgaatataatttctggttatggtgccacagctggtgcttctctg
tgtagtcatatggatgtggataagcttgcttttactggatcaacagaaaccgggaaaacc
atacttgaattggctgctaagagcaatcttaagcctgtgacattggaacttggagggaaa
tccccttttattgtttgtgaggatgctgatattgatacggccgttgaacaagctcatttt
gctctcttctttaatcagggccaatgttgttgtgctggttctcggacctatgttcacgag
aaggtctatgatgaatttctggagaaggcaaaggcacgcgccttgaaacgagtagttggt
gatccgtttaaatcaggcactgagcagggtcctcagattgattcaaaacagttcgataag
atcatgaagtacattagatctggtgttgatagtggagctactcttgaaactggcggtgag
caatttggtaaaaagggatactatattaggcccaccgtcttctctaatgttaaggatgat
atgctgattgcacaggatgagatttttggtccagtacagtccatcttaaaatttaaggat
cttgatgaagtggtacggagagctaatagttctcggtatggtctagctgctggagtattt
tcacagaacatcgacactgcaaacacgttggcacgagccttgagagttgggacggtatgg
attaattgctttgatacgtttgatgctacaattccttttggtggctataagatgagtggt
cagggaagagaaaagggagaatacggtctcaaaaattacttgcaagtaaaggcagttgtg
acaccattgaagaatccagcatggttataa

DBGET integrated database retrieval system