KEGG   Solanum lycopersicum (tomato): 101254670Help
Entry
101254670         CDS       T02665                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00500  Starch and sucrose metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101254670
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101254670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 101254670
NCBI-ProteinID: XP_004235226
UniProt: K4BIZ4
LinkDB All DBs
Position
3
AA seq 453 aa AA seqDB search
MFANLLLPKMNSLFPLCLIFSFFLPMFASSTVLFQGFNWESSNKQSGWYNSLINLVPDLA
HAGVTHVWLPPSSHSVSPQGYMPGRLYDLDASKFGNQQELKALIKALRDYGIKSVADIVI
NHRCADKKDSRGIYCIFEGGTTDDRLDWGPSFICKDDIQYSDGTGNLDTGLDFEPAPDID
HLNIRVQKELSDWMNWLKSEIGFDGWRFDFVRGYAPNITKIYMGNTSPDFAVGEFWNSLA
YGQDGKPDYNQDNHRNELVGWVQNGGGAVTAFDFTTKGILQAAVEGELWRLKDSHGKPPG
MIGVLPQNAVTFIDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPLVFYDHFFDWGLKD
GISALISIRKRSGICATSNVQILASDSDLYIAMIDQKIIVKIGPKLDLGNLIPPSYQVAT
SGQDYAVWEKKAFIYHTKCHHVQNGSQCLMSFD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctaaccttttgctcccaaaaatgaattccctttttcctctttgtttaattttc
tctttttttcttcctatgtttgcttcttccacggtgttgtttcaggggttcaattgggaa
tcgagtaataagcaaagtggttggtacaattctctcatcaatttagtaccagacttggct
catgctggagttactcatgtttggttaccaccatcatctcactctgtttctcctcaaggt
tatatgccaggaagattgtatgatttggatgcttccaagtttgggaatcagcaagaactg
aaagctcttattaaggctttacgtgactatgggatcaaatcggttgctgatatagtaata
aatcatcgatgtgctgataaaaaagatagcaggggaatatactgcatctttgaaggagga
acaacagatgaccggcttgattggggtccgtctttcatttgcaaggacgacatacaatat
tctgatggcacggggaacctagacacgggtttggactttgaacctgcccctgatatcgat
catcttaatatcagagtgcagaaagagttatctgattggatgaattggctcaagtctgaa
attggatttgatggctggcgtttcgattttgttaggggatatgcacctaacatcaccaag
atttacatgggaaacacgtccccggattttgcagttggtgaattttggaactctcttgca
tatggacaggacgggaaaccggactataaccaggacaatcataggaatgagctagttggt
tgggttcaaaatgggggtggggctgtaacagcctttgatttcacaactaagggaattctt
caagctgcagttgaaggagagttatggagattgaaagattcccatggaaaaccccctggg
atgataggtgttttgcctcaaaatgctgtgacttttatcgataatcatgatactggatcg
acacaaaatatgtggccattcccttcggacaaagttatgcaaggatatgcatacattctt
actcatccaggaattccattagtgttttatgaccatttctttgattggggcttgaaggat
ggaatatcagcactaatctctattaggaagaggagtgggatttgtgcaacaagcaatgtg
cagattttggcttctgattctgatctttatatagcaatgattgatcagaaaattattgtc
aaaattgggccaaaacttgatcttggaaatcttatcccacctagttatcaggtggcaact
tctggacaagattatgctgtatgggagaaaaaggcattcatttaccatactaaatgtcac
catgtacaaaatggttctcagtgtttaatgtcatttgactga

DBGET integrated database retrieval system