KEGG   Solanum lycopersicum (tomato): 101256299Help
Entry
101256299         CDS       T02665                                 

Definition
(RefSeq) protein cornichon homolog 4
  KO
K20368  protein cornichon
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sly04131]
    101256299
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sly02000]
    101256299
Membrane trafficking [BR:sly04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101256299
Transporters [BR:sly02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   101256299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 101256299
NCBI-ProteinID: XP_004242012
UniProt: A0A3Q7GXD4
LinkDB All DBs
Position
6
AA seq 139 aa AA seqDB search
MADVWAWLLFFFILIALLVMVVFQLMCLSDLEFDYINPYDSASRINAVVLPEFITQGVLC
LLYLITGHWVMALLCVPYMYYNYRLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLL
FISLFWLIYSALEDDEESL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtttgggcatggcttctcttcttcttcattctcattgctctccttgtcatg
gttgtttttcagctgatgtgcttatcagatttggagtttgattatatcaacccatacgac
tctgcatctcgtataaatgcagttgttttacctgagttcatcacacaaggagttctgtgc
ttgctctatttgataacagggcattgggtcatggcacttctatgtgttccatatatgtac
tacaattacagattgtacacgagaaggcagcaccttgttgatgtgacagagatttttaat
ctgcttaattgggaaaagaaacagcggcttttcaaactaggctatatcgtccttctcctc
ttcatatcattattttggttaatttacagtgccttggaggatgatgaagagtccctatag

DBGET integrated database retrieval system