KEGG   Solanum lycopersicum (tomato): 101256641Help
Entry
101256641         CDS       T02665                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00020  Citrate cycle (TCA cycle)
sly00190  Oxidative phosphorylation
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101256641
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101256641
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101256641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101256641
NCBI-ProteinID: XP_004232400
UniProt: A0A3Q7F7G5
LinkDB All DBs
Position
2
AA seq 629 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAANTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVTKNGDDPDAVIPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGAEQKPLEKDAGERTIAW
LDKIRNSNGSLPTSKIRLDMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRG
LIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTIGYWED
EKVRLEYRPVHMNTLDDEVESFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtgtcgcgtggtcttcgcgcttcctccaacagatctatctccggcggc
ggccattttcgccgactcttctcctcacaaactaatgtgggaggctcgtcctacacggta
gtcgatcacacatatgatgcggtggtggttggtgcaggcggtgctgggcttcgtgcagca
atagggttgtctgagcatggattcaatactgcttgcataaccaagctctttcctactcga
tctcacactgttgcagctcagggtggtataaatgctgcattaggcaacatgacagaagac
gattggaggtggcacatgtatgatacagtcaaaggaagtgattggttaggtgatcaggat
gctatccaatacatgtgtagagaagctccaaaagcagttatagagcttgagaattatggt
ttgcctttctctcgaacagaagatggtaaaatatatcaacgtgcatttggtggtcaaagc
ctggactttgggaaaggaggacaagcatatcgttgtgcatgcgctgcagatcggactggg
catgctctattgcatactctttatggccaggccatgaagcataatacacagttttttgtg
gaatatttcgctttggatttactaatgaacagtgatgggagctgccaaggtgtaatagca
ctaaatatggaggatggtaccttgcatcgattccgtgctgccaatacaattttggccacc
gggggttatggccgagcttacttctcggcaacatctgctcatacttgcactggagatggt
aatgctatggttgcgcgtgctgggcttcctcttcaggatcttgagtttgtgcaatttcat
ccaactggtatatatggggctggttgcctcattactgaaggatctcgcggtgaaggtggt
atcctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaactgccaaggat
cttgcctcaagagatgttgtttccagatctatgactatggaaattcgagaagggcgtggt
gtaggacctttgaaggaccatatctatcttcacctcaatcacttacctccagaggttctt
aaggagagacttccgggtatctctgaaacagctgccattttcgctggtgttgatgtaact
aaggaaccaattcctgttttacctaccgtgcattataatatgggaggaatcccaactaat
taccatggacaggtggtcactaaaaacggggatgatccagatgctgtgatccctggactg
atggctgctggtgaagcagcatgcgcatctgttcatggtgccaatcgtcttggtgcaaat
tctcttctagatattgttgtttttggacgggcatgtgctaatagggttgcagagatccaa
aaaccaggcgcggaacaaaagccacttgaaaaagatgctggggagaggaccattgcatgg
ttggacaagattaggaactcaaatggttcattgcccacctcaaagataaggctggacatg
caaagagttatgcaaaacaatgctgctgtcttccgcacacaagagacattagaggaaggt
tgccagctcattgacaaaacatgggagagtttccatgatgttcagttgaaggacagaggt
ttaatatggaacacagatcttatagagactattgagttggaaaatcttttaattaatgca
tgcatcaccatgcactcagccgaggcaagaaaagaaagcagaggagctcatgctcgtgaa
gattttacgaaaagagatgatgagaagtggatgaaacacaccataggatattgggaggac
gagaaagttcggctagaatacagaccagtgcatatgaacactctagatgacgaagtcgag
tcgttcccaccaaaggctcgtgtctactga

DBGET integrated database retrieval system