KEGG   Solanum lycopersicum (tomato): 101257737Help
Entry
101257737         CDS       T02665                                 

Definition
(RefSeq) dnaJ protein ERDJ2A
  KO
K09540  translocation protein SEC63
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03060  Protein export
sly04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    101257737
   04141 Protein processing in endoplasmic reticulum
    101257737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sly03110]
    101257737
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sly02044]
    101257737
Chaperones and folding catalysts [BR:sly03110]
 Heat shock proteins
  HSP40 / DNAJ
   101257737
Secretion system [BR:sly02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   101257737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ DUF2457
Motif
Other DBs
NCBI-GeneID: 101257737
NCBI-ProteinID: XP_004234196
LinkDB All DBs
Position
3
AA seq 686 aa AA seqDB search
MADTGENSALFPIFILSIIALPLVPYTILKLLRVASKKEKSIHCACSVCSRSGKYRKSIF
GRISKFSTCSNFTLLLLWVIVIFLVYSIKQSSREIEAFDPFSILGLAPGVTESAIKKAYR
RLSIQYHPDKNPDPAAHKYFVEYISKAYQALTDPVSRENFEKYGHPDGRQGFQMGIALPQ
FLLDFNGSSGGILLLWILGGFILLPMAFGVVYLSRASKYGGNNVRRETLVTYFELVKPSL
APSKVMDVFVKAAEFMDIPVRRADDEPLQELFKLVKSELNLDGKNARQEQAKFWKQHPAI
VKAELLIQAHLLRKADTFSSNLQQDYKHVLQFTPRLLEGLIKMATVPRTAKGHGWLRPAI
GIVELSQCIIQAVPLSARKAGSGSSDGVASLLQLPNFNDAVITKIGKKVRTLQNLLDMTL
QERAELLSDVAGLSAAEVQDVEKVLELMPRATIEVTCETEGEEGIQEGDIVTVQAWVTVR
RANGLIAALPHAPYYPFPKGENFWFLLADANSNDVWFSESINFMDEAAAITTASTITEAK
MEASGANMEEIAAAVKDAVAKVKRGCRLILGKIQAPQAGSYSLNSHLMCDTWIGCDTKTN
LKLKVLKRSRAGSRGGHVAGGVQDENDVEDEDEDDIEEDEEGDQSEYSEDEDEDKNEDED
DEVDKPNNNSNRKGFANGSARRKGRK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctgacactggagagaatagtgccttgttcccaatttttatattgtcaataattgcc
ctgcctttagtaccctatacaatacttaaattactccgtgttgcttcaaagaaggaaaag
agtattcactgtgcgtgttcagtttgctctcgatcaggaaaatatcgcaaatccattttt
ggaaggatctctaagttttcaacatgtagcaactttaccttgctgttgctttgggtcatt
gtgattttccttgtttatagcatcaagcaaagtagtcgtgagattgaagcttttgatccg
ttcagtattcttgggctagcaccaggagttaccgaatctgcaataaagaaagcatatagg
agactttcaatacaataccacccagacaaaaaccctgacccagctgctcataagtatttt
gtggagtatatttccaaagcttaccaggccctgacagatccggtctcaagggagaatttt
gagaaatatggacatccagatggcagacagggttttcaaatggggatagcacttcctcag
tttttgcttgattttaatggctcgtctggtggtatattattactttggattcttggaggt
tttatactattgccaatggcttttggtgttgtttatctatcaagagcatcaaagtatggg
ggaaataatgtcaggcgtgaaactcttgtcacttattttgaattagtgaagccctccttg
gctccaagcaaagttatggatgtattcgttaaggcagctgagttcatggatattccagtt
cgaagagctgatgatgaacctcttcaggaactcttcaaacttgtgaaaagtgaactgaac
ctggatggtaagaatgccagacaggaacaagcaaaattttggaaacaacatcctgctatt
gtcaaggccgaattgttgattcaagcccatttacttcgtaaagcagacactttctctagt
aacttgcagcaggattacaaacatgtgctgcagtttacacctcgccttctcgaagggcta
atcaagatggcaactgtgccacgcactgctaagggacatggttggctaaggcctgcaatt
ggaatcgtcgagctctcccagtgcattattcaggccgttccccttagtgctaggaaggca
ggttcaggatcctctgatggtgttgcttcgcttttacagcttccaaattttaatgatgca
gtcatcacaaagatagggaagaaggtgcgtacactacagaacctcctggacatgaccctt
caagaacgtgctgagctgctttctgatgttgctggcctatccgctgctgaagtgcaagac
gtagagaaggtgctagaattgatgcctcgtgcaacaattgaagttacatgcgagactgag
ggtgaggaaggcatccaagagggggacattgtcactgtgcaggcatgggtgacagtcaga
cgtgctaatggtttgatcgctgctcttccacatgctccatactatccattccccaaggga
gagaatttctggtttttacttgcagatgccaattcaaatgatgtctggttttctgaaagt
atcaactttatggatgaagcagcagccataacaactgcttcaacaataaccgaagcgaaa
atggaagcatcgggggcaaatatggaggagattgctgctgctgttaaagatgctgttgcg
aaagttaagagagggtgccgactgatcttgggcaagatccaagctccacaggcaggaagt
tacagtctaaacagtcatttgatgtgtgacacatggattggctgcgacacaaagacaaac
ttaaaactaaaagtattgaaaaggagcagagctggaagtcgaggtggtcatgtggctggg
ggagtgcaggatgagaatgacgttgaagatgaagacgaagatgacattgaagaggacgaa
gaaggtgatcagagcgagtatagcgaggatgaggatgaggacaagaatgaagacgaggat
gatgaggttgacaaaccaaacaataattctaatagaaagggctttgctaatggctccgct
cgaagaaagggtagaaagtaa

DBGET integrated database retrieval system