KEGG   Solanum lycopersicum (tomato): 101257857Help
Entry
101257857         CDS       T02665                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00020  Citrate cycle (TCA cycle)
sly00620  Pyruvate metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
Module
sly_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101257857
   00020 Citrate cycle (TCA cycle)
    101257857
   00620 Pyruvate metabolism
    101257857
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101257857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 101257857
NCBI-ProteinID: XP_004238940
UniProt: K4BXC7
LinkDB All DBs
Position
5
AA seq 459 aa AA seqDB search
MASLQSSAISFSSSLGRFSSTRTMLPQKPRKYKLPVVESKIREIFMPALSSTMTEGKIVS
WVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAVIVVNEGETALVGAPIGLLAETED
EIAEAKAKAKGQSGGSSSGSESTPEPQSPVVVSSDEPKKIVATPNAKKLAKQHKIDINKV
KGTGPFGRITSEDVEKAAGITPAPSKSISPPPPPPAAAPAAGAPAKAAPVSLPEIPGSTV
VPFTTMQVAVSKNMVESLSVPTFRVGYPVITDALDALYLKVKKKGVTMTALLAKAAAMAL
AQHPVVNSSCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEK
ARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTPVADADGFFSV
KNKMLVNVTADHRVVYGADLAAFLQTFSKIIENPDSLTM
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacttcaatcctctgcaatatccttctcatcttccctcggccgtttctcatcc
acacgcacaatgcttcctcagaaacccagaaaatacaaactcccggttgttgaatcgaag
attcgagagattttcatgccggcattgagctcaacgatgactgaaggaaagatcgtatct
tgggttaaatcggaaggtgatgttttgtctaaaggtgaatctgtcgttgttgtggagtcg
gataaagctgatatggatgttgagacgttttacgatgggattttagctgttattgttgtt
aacgaaggtgaaactgcacttgttggtgctcctattgggttattagctgaaacagaagat
gaaattgctgaagctaaagcgaaagcgaaaggacaatctgggggttcttcttctggatcg
gagagtactcctgaacctcaatctccggttgtggtttcttctgatgagccgaagaaaatt
gttgcaaccccaaatgcgaagaaattggcgaagcagcataaaattgatatcaataaggtg
aaggggaccggcccatttggacggattacatcggaggatgttgagaaagctgctggaatt
actccggcaccgtccaagagtattagcccacctcctcctcctcctgctgctgctccggca
gcgggtgcgccagctaaagctgctccggttagtttaccagagattcctgggtcaacagtt
gttccgttcacaacaatgcaagttgcagtgtccaagaatatggtggagagtctctctgtt
ccaacatttcgtgttgggtatccagttattactgatgcccttgatgctttatacctaaag
gtcaagaagaagggtgttacaatgaccgcattgttggccaaagctgcggcaatggcacta
gctcaacatccagttgtgaattcttcttgtaaagatggaaagagctttacgtacaacagc
agtattaatattgctgttgcggtggccattaacggtgggttgataacaccggtgcttcag
gatgctgacaagttggatctgtatctgttgtctcaaaagtggaaggaactggtagagaag
gctagggctaagcaactacaaccacatgagtacaattcagggactttcactttgtccaac
ttgggcatgtttggtgtggaccgatttgatgctattcttcctcctggccagggggctata
atggctgttggagcatcaaagccaactcctgtagctgatgctgatgggttcttcagcgtc
aaaaataagatgctggtaaacgtcacagcagatcaccgagttgtgtatggcgcggactta
gcagccttccttcaaactttttccaagattattgagaatccagatagcttgacaatgtag

DBGET integrated database retrieval system