KEGG   Solanum lycopersicum (tomato): 101258046Help
Entry
101258046         CDS       T02665                                 

Definition
(RefSeq) S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X1
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
sly  Solanum lycopersicum (tomato)
Brite
Transporters [BR:sly02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   101258046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Gly-zipper_YMGG Gly-zipper_OmpA Gly-zipper_Omp
Motif
Other DBs
NCBI-GeneID: 101258046
NCBI-ProteinID: XP_004252565
LinkDB All DBs
Position
12
AA seq 308 aa AA seqDB search
MAINSETEFPEDRLNFEALKSHHKSKAIASISKQQNPFDLLRILYEGAVSGAAAGVVVEA
ALYPIDTIKTRLQAVRGGGQIILKGLYSGLAGNLVGVLPASAIFVGVYEPTKRKLLDSFP
ENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQTGQFSSAPDAVRLIVAKEGFRGLYAG
YGSFLLRDLPFDAIQFCLYEQLRMGYKLAAKRDLKDSENAMIGAFAGAITGAITTPLDVI
KTRLMVQGSAKQYEGILHCVKTIARDEGASTLFKGIGPRVLWIGIGGSIFFGVLERTKKL
VAAKQPVD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaactcggagacggaatttccagaagatagactgaacttcgaggcactcaaa
tcccaccacaagtcaaaagctattgcatcaatcagcaaacaacagaatccatttgatctc
ttacgcatattgtatgagggagctgtatctggagctgctgctggtgttgttgtagaagct
gctttgtatccaattgatacaattaaaactcgtcttcaagcagttcgtggtggaggacag
atcattttgaaaggtctttattcaggattggctggaaatctagttggagtcttaccagca
tcggcaatatttgttggtgtatatgaacctacgaagagaaaattgctggacagcttccct
gaaaaccttagtgccttagctcatttgactgcaggtgctattggcggagctgcttcttct
attgttcgtgtacccactgaggtagttaagcaaaggatgcagactggccaattttcttct
gcccctgatgcggtccgactcattgttgctaaggaagggtttagaggcctttatgctggg
tatggttcttttctactacgagacttaccatttgatgctattcagttctgtttatacgag
cagctgcggatgggttataagttagctgccaaaagggaccttaaagattccgagaatgca
atgattggtgcctttgcaggtgcaataacaggagctataactactcctcttgatgtgata
aaaacaagattgatggttcagggttcagcaaagcagtatgaaggcattttgcattgtgtt
aaaactattgcaagagacgaaggagcctctactctttttaagggaatagggccacgagta
ctttggataggtattggaggatcgatattttttggtgttcttgaaaggacaaagaaacta
gttgctgcaaaacagcctgttgattag

DBGET integrated database retrieval system