KEGG   Solanum lycopersicum (tomato): 101259137Help
Entry
101259137         CDS       T02665                                 

Definition
(RefSeq) FIP1[III]-like protein isoform X1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101259137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sly03019]
    101259137
Messenger RNA biogenesis [BR:sly03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101259137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 101259137
NCBI-ProteinID: XP_004253153
UniProt: A0A3Q7JYT7
LinkDB All DBs
Position
12
AA seq 1130 aa AA seqDB search
MVNIAGDDDDDFGDLYADVEVQASSAINALQSSMLVQTEVNEVDYNASVGNCNRENAVRG
EEDRESESGDDLNILLNDDEGDDDFLNAGCDEDEIEGNGGFIVSDKGNGLGQNSNGSGSG
DGEKNSYKNTRPPQAAYSNHLKANGSSCAPSYCTTFVKGNWEDNSYTQRVGSSFAAQNGQ
SFSLPRSRNILDVNIDMFEKKPWRYPGSDLTDYFNFGFDEDSWKQYCNCLDEHREQAKKV
FKESDYKTPKISKPKGREIEVEESMIERLPSTDVERPQYRDSSVVIQIALQQSMEDPISS
TKEQKEASENGDVGGDKKEFLCFSSACEDELASLEGTGEGSGNSTSGRNTPVCEHVSMGS
DNYENSEYSDADERHHQEGTYCNVDQTSGAIKSTHDANKSSERDISDPRQPIKLQEPLCG
GGREHSPGSSCCSLSHGGTSGDGTFLNLEKSHDHHTRLISNAESELREKGTTDYQPISRT
DHNRTKSGDFKYFTQGRRSVQRDLLHDRRRPGRMGETIPAHLKDEDSHKSDARILYERRN
SSVIRHRQRDRRYAFDSHEREDTSHFKRAEPFYSNAGRFSDYPCRGSFTKNPQMEYQLRC
RYDKNWSGGRSVKRKLDHLELSTYTDDKLLERDRPHYGGRLTVQDMENISFHESEQWIDK
YISYSDDENPSQRIRKIDQLPKKKRVRTDDLVTECNYIYDIMEETDNRYRPYNHRDTDIL
EDGYDVNLTYFRREIKSPSRGQRRDISPCKSSNDICFMDLKDMGGRFDGYRPSSFCLYRE
SCTSSRRWQSLELPRGRNRIFSGTRKCDGGQFASLTNSIGANQTIKYPANQDIFKRRRGG
RQSEGMQWVEDENNSGYQENVFDAERTSYSFRRTSSDKRFKSFDNNHGPNPVEKLLDDRH
VEQEKYKLIREGNNANQFGQGSKVFHKDNHWRRFPRGRDSVDTDLIVENGESSGRCSKAG
GVTSFDRYGHLDSDCYLKLKPVDGTSKLHFRETLRTRNVTTDPKENDKERLAIFSDANQE
ESLDIEEGQIIEEMNEKIVKKRITYSGKSEIGEMKNFATGKNVEGQGSPKILEIIAKMEK
RGERFKQPIALKSDTKNISTPLVDSFAVSTEPMQPRPARKRRWAASKATV
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacatcgccggcgacgacgacgatgatttcggcgatctctacgccgacgttgaa
gttcaagcaagttcagcaatcaatgctctacagagttcaatgctggttcaaacggaagtc
aatgaggttgactacaatgcttccgtcggaaactgtaatcgtgaaaatgctgtaagagga
gaagaggatcgtgagagcgaaagtggagatgacttgaacatactgttgaatgatgatgaa
ggtgatgatgattttctcaatgctggatgtgatgaggatgaaattgagggaaatggaggt
tttattgttagtgataaaggaaatggtttaggacagaattcaaatggcagcggaagtggc
gatggagagaaaaacagttacaagaacacacgaccaccacaagcagcatattctaatcat
ctcaaagccaatggatcttcttgtgcgccttcttactgtacaacatttgtcaagggcaac
tgggaggataatagctacacacaaagggtgggctcaagctttgctgctcaaaatggacag
agcttctcacttcctcgatcaaggaatatcttggacgtgaatattgatatgtttgagaag
aaaccttggcggtatccaggctctgacttgacagattattttaattttggctttgatgaa
gatagttggaaacagtattgcaactgcctggatgagcaccgagaacaagcaaaaaaggta
ttcaaggagtcagactacaagactccgaaaattagtaagccaaaaggtagagaaatagag
gtggaagagagcatgattgagcgcctaccatcaacagatgtggagcgtccacaatatcgg
gattctagtgttgtcatacagattgctttgcagcagtcaatggaagatcctataagttct
acaaaagagcagaaggaagcatctgagaatggagatgttgggggagataaaaaggagttt
ctctgtttcagtagtgcctgcgaagatgagttagccagcttggaaggaactggagaagga
tcaggcaactctacatctggaaggaatacacctgtttgtgagcacgtgtctatgggttca
gataactacgaaaattccgagtactctgatgcagatgagcgacaccaccaagaggggacc
tactgtaatgttgatcaaacctcaggagcaattaagtctactcatgatgcaaataaaagc
agtgagagagacatatctgatccaagacaacctataaagttgcaagaaccactgtgtggt
ggaggcagagagcatagcccaggttcatcttgttgttctttaagtcatggtggcacatct
ggagatgggacttttcttaacttggagaaatctcatgatcatcatacaaggttaatatca
aacgcagaatctgagttacgggagaagggtacaactgattaccagccaatttccagaacc
gatcacaacagaacaaagtctggtgattttaaatattttacacaaggtagaaggtctgtg
caaagagatctgctgcatgacagaagaagacctggtcgaatgggtgaaacaattcctgct
cacctgaaagatgaggattcccacaaatctgatgctaggatactgtatgaaaggcgtaat
tcatctgtgatccgacacagacagagagatagacgatatgctttcgactctcatgaaagg
gaagatacttcacattttaagagggcagaacccttttactctaatgcaggacgattttct
gattatccatgccggggttcttttacaaaaaatcctcagatggaatatcagttaagatgc
agatatgacaaaaactggtctggcggtcgaagtgtgaaaagaaagctagatcatcttgaa
ctatcaacttatacagatgataaattgttggaaagagatagaccccattatgggggaagg
ctcactgttcaggatatggagaacatttcttttcatgaatcagaacaatggatcgataag
tatatttcctattcagatgatgagaatcccagtcaacgtattcggaaaatagatcagctg
ccgaaaaagaagagagtgaggactgatgatcttgtaactgaatgtaattacatctacgat
atcatggaagagaccgataacagatatagaccatacaaccacagggatactgatattcta
gaagatggctatgatgtaaatttgacttatttcagaagagaaattaaaagccccagtagg
ggccaaaggagagatatcagtccttgcaaaagttcaaatgatatatgcttcatggatcta
aaggatatgggagggagatttgatgggtatcgaccttcatccttttgtttgtatagagaa
tcttgtacttctagcagaaggtggcagagccttgaactgccacgtggcagaaacagaata
ttcagtgggaccaggaaatgtgatggtggtcagtttgctagtttgaccaactccatcggt
gccaatcagacaatcaagtatcctgctaatcaggacatttttaaaagaagaagagggggc
cggcagtctgaagggatgcaatgggttgaagatgaaaacaattctggttatcaggaaaat
gtattcgatgctgagaggacgtcatattcgttcagaagaacttcaagtgacaaaaggttt
aagtcatttgacaataatcatgggcccaacccagtagaaaagcttttagatgacaggcat
gtggagcaggaaaaatacaaattgatcagggaaggcaataatgccaatcaatttggtcaa
gggtctaaagtttttcataaagataatcattggaggagattcccaagaggaagagattct
gttgacacagacttgattgttgagaacggagagtcctccggaagatgctccaaagcaggg
ggtgtaacatcctttgacaggtatggccacttggattcagattgttatttgaagctgaag
cccgtcgatggaactagcaaactccatttcagggagacactcagaactcgaaatgtgaca
actgatcctaaagaaaatgataaagaaaggcttgctatattctcagatgccaaccaggaa
gagtctttggatattgaagaaggtcagataattgaagaaatgaacgagaaaatcgttaaa
aagagaatcacgtattctggaaaatcagaaatcggtgaaatgaagaatttcgctactggt
aaaaatgtggagggacagggcagccctaagattttggagatcatagcaaagatggaaaag
cgtggagagcgtttcaagcagcctattgctctcaaaagtgatacaaagaatatctctacg
cctttggttgattcgtttgctgtgtcgactgaacctatgcaaccaagaccagcacgaaag
aggagatgggctgcaagcaaggcaactgtttag

DBGET integrated database retrieval system