KEGG   Solanum lycopersicum (tomato): 101259840Help
Entry
101259840         CDS       T02665                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00030  Pentose phosphate pathway
sly00051  Fructose and mannose metabolism
sly00052  Galactose metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
sly01230  Biosynthesis of amino acids
sly03018  RNA degradation
Module
sly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101259840
   00030 Pentose phosphate pathway
    101259840
   00051 Fructose and mannose metabolism
    101259840
   00052 Galactose metabolism
    101259840
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101259840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sly01009]
    101259840
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sly03019]
    101259840
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101259840
Protein phosphatases and associated proteins [BR:sly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101259840
Messenger RNA biogenesis [BR:sly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101259840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 101259840
NCBI-ProteinID: XP_004238509
UniProt: A0A3Q7G4D7
LinkDB All DBs
Position
4
AA seq 499 aa AA seqDB search
MGSLVDSFALHNLNKKIVMGDNGYVFEDVPHLSDYIPSLPTYPNPLKKNPSYSVVNQYFV
DEDDTVAQNIVVRKNSPRGIHFRRAGPSQDVYFKADDVNACIVTCGGLCPGLNTVIREIV
CGLYSMYGVARVMGIDGGYRGFYSKNTIPLTPNVVNDIHKRGGTILGSSRGGHVTKKIVD
SIQDRGINQVYIIGGDGTLKGASLIFEEITRRGLNVVVVGIPKTIDNDIPVIDKSFGFDS
AVEEAQRAISAAHVEATSFENGIGVVKLMGRDSGFIAMYASLASRDVDCCLIPESCFYLE
GRGGLFEYIEQRLKENGHMVIVVAEGVGQDDEQVDVGLWISTRIKEHFSKEKKMMINLKY
IDPTYMIRAIASNASDNMYCTHLAQSAVHGAMAGYTGFTVGPVNNTHAYIPFDRITEKQN
KVDITDMMWAQLLSSTNQPSFLSTARSADNIEANKDEEPPIQLSDEETNQLSFLTTRVDI
NEANKNKEPPTELSDGETN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggatcattggttgatagttttgctttgcataatttgaacaagaaaatcgtgatgggt
gacaatggttatgtttttgaagacgttcctcatttgtctgattacattcctagtcttcct
acgtatcctaatccattgaagaaaaatccttcctattcagtcgtcaatcagtattttgtc
gatgaagatgatacagttgctcaaaatattgttgtccgcaagaacagtccaagagggata
cattttcgtcgagctggtccttcccaagacgtttattttaaggcggatgatgttaatgca
tgtattgtaacatgtggaggtttatgccctggtctcaatacagttatcagggaaatagta
tgtggcttgtactctatgtatggtgtagcaagagtcatggggatagatggaggatatcga
ggtttctattccaaaaacacgattccattgacacctaacgttgtgaatgatatccataaa
cgtggtggaacgattcttgggtcatctcgaggaggtcatgttactaagaagatagtagat
agcattcaggatcgaggaattaatcaggtttatataattggaggagatggaacgcttaaa
ggagcatcgttgatatttgaggaaattacgaggcgtggtctaaatgttgtagttgttgga
atccccaagacaatagataacgatataccagttattgacaagtcttttggttttgattct
gcggttgaggaagctcaacgtgctattagtgctgctcatgttgaagctacgagttttgag
aatggaattggggttgtgaagttaatgggacgggatagtgggtttatagcaatgtatgct
agtcttgctagtcgagatgttgattgttgtttgattccagaatcctgtttctatcttgaa
ggacgcggtggactgtttgagtatatcgaacaaaggctgaaagagaatggacacatggtt
atcgttgtagctgaaggtgttggacaagatgatgagcaagttgatgttggtttatggata
tcgacaaggataaaggagcatttttcgaaagaaaagaagatgatgatcaatctgaagtat
atagatccaacatacatgattcgggctattgcaagtaatgcatctgataatatgtattgc
actcatcttgctcaaagcgcggtacatggagcaatggctgggtacacaggctttacggtt
ggtcctgtcaacaacacacatgcttacataccctttgatagaatcactgagaaacaaaac
aaggttgacattacagacatgatgtgggcacaacttctatcttcaactaatcaacctagc
ttcttgtcaacagcgagatcagctgataatattgaagcaaacaaggacgaagaaccacct
attcaattatcagatgaagaaacaaatcaacttagcttcttgacaaccagagtcgatata
aatgaagcaaacaagaacaaagaaccacctactgaattatcagatggagaaacaaattaa

DBGET integrated database retrieval system