KEGG   Solanum lycopersicum (tomato): 101264994Help
Entry
101264994         CDS       T02665                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00052  Galactose metabolism
sly00500  Starch and sucrose metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101264994
   00500 Starch and sucrose metabolism
    101264994
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101264994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101264994
NCBI-ProteinID: XP_004233180
LinkDB All DBs
Position
2
AA seq 903 aa AA seqDB search
MKGIQFPSLNRNTFIIFFLIHLSIFSPYFAISIKQKEAQQQVIGYGYSIKSVAITGNSIF
ANLQLISTSSVFGTDIHNLILIASLETNDRLRIRITDVNHQRWEVPEEILRRPPPPSPPS
TSNSSSENHFPITLSNPNSDLEFTLHNTTPFSFTVRRRFTGDTLFDTSPENENPDTFLIF
KDQYIQISSALPTTRANLYGLGEHTKSSFKLTHNQTLTLWNADIGSSNADLNLYGSHPFY
MDVRSSDPAKETAAGVSHGVLLLSSNGMDIVYTGDRIIYKVIEGLIDLYFFAGPSPEMVV
DQYTQLIGRPAAMPYWSFGFHQCRWGYKNIDDVELVVESYAKARIPLEVMWTDIDYMDGF
KDFTLDPVNFPLERVNFFLRKLHQNDQKYVLIVDPGISINNTYDTYRRGMEADVFIKRDN
MPHQGVVWPGNVYYPDFLNPATEVFWRNEIEKFQDLVPFDGLWLDMNELSNFITSPPTPS
STFDDPPYKINNSGDHLPINYRTVPATSTHFGNTIDYNVHNLYGLLESRATYSALVNVTG
KRPFILARSTFLGSGRYTSHWTGDNAATWNDLAYSIPTILNFGLFGIPMVGADICGFSSN
TTEELCRRWIQLGAFYPFARDHSAKDTTPQELYSWDSVAAAAKKVLGLRYQLLPYFYMLM
YKAHTKGTPIARPLFFSFPQDAKTFDISTQFLLGKGVMISPVLKQGATSVDAYFPAGNWF
DLFNYSRFVSLNQGTYLTLDAPPDHINVHVREGNILVMQGEAMTTQAAQRTAFKLLVVLS
SSENSTGELFVDDDDEVQMGREGGRWTFVKFNSNIIGNKIVVKSEVVNGRYALDQGLVLE
KMTLLGLENVRGLKSYELVGSHQQGNTTMKEKLKQSGQFVAMEISEMSILIGKEFKLELY
IIT
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatacaatttccatctttaaacagaaacacctttataatcttctttttgatc
catttatcaatattttcaccatattttgccatatccattaaacagaaagaagctcaacag
caagtaattggctatggttactcaatcaaatctgtggctatcactggaaattcaattttt
gctaatcttcaactcatcagcacttcttctgtttttggtactgatattcacaatcttatc
ctcattgccagtttggaaacaaacgatcgtctccgaatacgaataacggacgttaaccac
caacgatgggaagtgccggaagaaattctccgccgtccaccaccgccatcgccgccgtca
acttccaactcctcatcagaaaaccacttcccaattacgctctctaacccaaactcagac
ctagagttcacccttcacaacaccaccccattcagcttcaccgtccgccggcgattcacc
ggggatactcttttcgatacttcgccggagaacgaaaaccccgatacattcctcatattc
aaagatcagtacatccagatctcctcggcactaccaactaccagagctaacctttacggg
ctcggagagcacactaaaagctcgtttaagcttacgcacaaccagactttgactctatgg
aatgccgacattggaagttccaacgcggaccttaatctctatggatcccatcctttttat
atggacgtccggtcgtcggatccggcgaaggaaacggccgccggagttagtcatggggtt
ttgcttctgagtagcaatggcatggatattgtatatacgggtgatagaattatttacaag
gtaattgaagggttaattgatttgtatttcttcgccggaccttcgccggaaatggtggtg
gatcagtatactcagcttattggtcgtcctgctgctatgccatattggtctttcggattt
caccaatgccggtggggttacaagaatattgatgatgttgaactggtagtggaaagttat
gcaaaggctaggataccgctggaggttatgtggactgatattgattacatggatggtttt
aaggacttcacactcgatccagttaacttcccactggagcgggtaaatttttttctcagg
aagcttcatcagaatgatcagaaatatgtactaatagtagatccaggaattagtatcaac
aatacatatgacacctataggagaggcatggaagcagatgtcttcataaaacgcgataat
atgccccaccaaggggttgtttggccagggaatgtttactatcctgattttctaaatcca
gctactgaagtattttggagaaatgaaattgagaagttccaggatctcgtaccttttgat
ggcctgtggcttgacatgaatgaattgtcaaacttcattacttcccctcctacaccatca
tccacctttgatgaccctccgtacaagataaacaactctggcgatcacttgcccatcaac
tatagaacagttccagccacttcaacacattttggtaatacaatagattataatgtccat
aacctttatggattactagaatctagagccacctatagtgctttggttaatgtcactggt
aaaaggccattcattcttgcaagatcaacttttcttggctctggcagatatacgtcacat
tggactggagacaatgctgctacatggaatgatttggcatactccattcctactatcttg
aactttggattgtttggaattccaatggttggagctgatatatgtggtttttcaagtaac
actactgaagagctttgccgccgctggattcagcttggagcattctatccatttgcaaga
gaccactctgctaaggacacaaccccccaagagctctatagttgggattcagttgctgca
gcggccaagaaagtccttgggctccgatatcagttacttccgtacttttatatgcttatg
tacaaggcacatacaaaagggactcccattgcacgacccctcttcttctctttccctcaa
gatgccaagacatttgatatcagcacgcagttccttctcggtaaaggtgtcatgatctca
cctgtacttaagcaaggagcaacctctgttgatgcatatttccctgctggaaactggttt
gacctcttcaattactctcgcttcgtgagtttgaatcaaggaacatatctgacacttgac
gcaccaccagatcatataaatgtacacgttcgtgaagggaacatattggtcatgcaaggg
gaagcaatgacaacacaagctgcacagaggactgcattcaaactccttgtcgtgctgagc
agcagcgaaaacagcacaggagaactatttgtggacgatgacgatgaggtgcagatggga
agagagggagggaggtggacgttcgttaagtttaacagcaatatcattggcaataaaatt
gtggttaaatcagaggttgtgaatggacggtacgcgctggatcaaggattggtccttgaa
aagatgacattattaggtttggaaaatgtgagaggattgaagagctatgagcttgttgga
tcacaccagcaagggaacacaacaatgaaggaaaaacttaaacagagtggacagtttgtt
gctatggaaatctcagagatgtcaatactgatagggaaagagttcaaattggagctatac
atcattacttaa

DBGET integrated database retrieval system