KEGG   Solanum lycopersicum (tomato): 101266429Help
Entry
101266429         CDS       T02665                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    101266429
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sly03400]
    101266429
Enzymes [BR:sly01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101266429
DNA repair and recombination proteins [BR:sly03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     101266429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C PTCB-BRCT RNA_ligase BRCT DNA_ligase_IV mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 101266429
NCBI-ProteinID: XP_004242917
LinkDB All DBs
Position
7
AA seq 1172 aa AA seqDB search
MATSAVDGGGNSSVGGEDIKFSVMVSLFKWIQKSKSSVKKRSKFRKFMDTFCRKPQDNFV
AMRLILPGLDRERGSYGLKEHVLATCLIDALAMSRDSDDARRLLNWRKGGPKTGSNAGNF
SLVAAEVLQRRQGMASAGLTIKELNDFLDHLASSENRAEKTSILSDLIRKTNAQEMKWII
MIILKDLKLGISEKSIFHEFHPDAEDLFNVTCDLKLVCEKLRDRSQRHKRQDIEVGKPVR
PQLALRVSNVSAAWKKLYGKEVVVECKFDGDRIQIHKNNSELNFFSRNFLDHQEYAHGMS
DVITQNILADKCILDGEMLVWDASINRFAEFGSNQEIAKAAREGLDSDRQLCYVAFDILY
VGDTSVIHRSLKERQEILQKVVKPIKGRLEILVPNGGLNAHRLSGEPCWSIIAHSVDDVD
KFFKGTVENRDEGIVLKDLTSKWEPSDRSGKWLKLKPDYVRPGSDLDVLIIGGYYGSGRH
GGEVAQFLVGLAEPPAPNTYPRRFISFCRVGTGVSDEERNTIVTRLKPYFRKYEYPKQAP
PTFYQVTNNSKERPDVWVESPEKSIIVSITSDIRTTRTEVFAAPYSLRFPRIDKVRYDKP
WHECLDVQSFVDLVHSTNGTTQREDNYGVEQDHESKTIRSSRKREKKNVFAVPSHFVQTD
VSRIKGETSMFSDMVFYFANVPSSHTLESLHKMVVEHGGAFSMNLNKSVTHCIAAESRGI
KFQAAKLHGDVIQCSWLFDCCLQKKLLPLQPKYFLFLSDSTKKKMEAEVDEYSDSFFSDI
SIEEIKLLLRNIEHPEDSKTVEYYKKKYCPKDEWARFHGCCIYFFIPKQCLEYSDCKVLV
ELAMKRMKVEISVGGGKVGDNLFHATHVVVMSLPEIDVKFNEVLNSFSEAEKHVLYNTKL
HVVGARWLEDSLKEDQKLLEESYSLKPSNFQMSISEKSRHDKQKGDSEKCKRPSSLDKHG
GQIKAKGISDQGRAITLPKRGRKRDRGRPTGSATAKGKVGINIPRTVKRKVTSSRAKIHE
NESDESATSCEHLRNDEGEAAVGSYETTAVRSSGVQNEDVQDLELSEDGKTLPPGTAECS
VINERLDKAHETSYGSGNIARGKDKVDEKLEDPVDPVQAMLLHMIPHLDSKPTRSIDTLV
KDDKPDADTNPSPKKKKKISYKDVAGELLKDW
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttccgccgtagacggtggtggtaatagtagtgttggcggagaagacataaaa
tttagtgtaatggttagcctttttaagtggatacagaagagtaaatcatcagtgaagaag
cggtccaagttccggaagtttatggataccttctgcaggaagcctcaggacaatttcgtt
gccatgcgccttattctccctggcctcgaccgtgagcgtggctcttatggccttaaggag
cacgtcctcgctacttgcctcattgacgcacttgcaatgtcccgcgattccgatgatgca
cgccgtctccttaactggcggaaaggcggtcccaaaactggctctaatgccggcaacttc
tctcttgttgccgctgaggtcctccagcgcagacagggaatggcttctgctgggctaaca
attaaggaactaaatgacttccttgatcacttggcctcaagtgaaaatagagcagagaag
acttcaattctgtctgatctaatcaggaaaacaaatgctcaagaaatgaaatggattata
atgataatcctcaaagatcttaagttgggaattagtgaaaagagcatcttccatgaattc
catccagatgcagaggacttattcaatgtcacatgcgatctaaaattagtttgtgaaaag
ttgagggacagaagtcaacgacataaacgccaggatattgaagttggaaaacctgtccgc
cctcagctggctcttagggtcagcaatgtatctgctgcatggaaaaagctttacgggaaa
gaagtagttgttgagtgcaaatttgatggggatcgcatccagattcacaaaaataattct
gagctaaacttcttttcaagaaactttctggatcatcaagagtatgctcatgggatgtca
gatgttattactcagaatatcctcgctgacaagtgcatactcgatggtgaaatgttggtt
tgggatgcatcaataaaccgctttgcagagttcggttccaatcaagaaatagcaaaggca
gcaagagagggtcttgatagtgataggcagttgtgttatgttgcgttcgatattctttat
gttggggataccagtgttattcatcggagcttgaaggaacgtcaagagattctccagaaa
gttgtgaagcccataaaaggccgtttagaaattttggtccctaatggcggtcttaatgct
catcgtctttctggggagccctgttggtcgatcattgctcatagtgttgacgatgtcgat
aaattctttaaaggaactgttgagaatagagacgaaggaatagttttgaaagatttaact
tcaaaatgggaaccaagtgatcggagtggaaaatggctaaagttgaagcctgattatgtt
cgacctggctctgatttggatgttcttattatcggaggctactatggttctgggcgacat
ggaggagaggtagctcaatttctggtgggtcttgctgagcctccggctccaaatacatat
cccagaaggttcatttctttttgcagagtaggcactggagtttctgatgaggaacgcaat
accatagtaactcgattaaaaccttatttcaggaagtatgagtacccgaagcaggcacca
ccaaccttttatcaagtaacaaataattcaaaagagcgacccgacgtgtgggttgaaagt
ccagagaaatccatcattgtttcaattacaagtgatattagaacaacaagaactgaggtg
tttgctgctccatacagcttgagatttccgcgtattgataaagtcagatatgacaagcct
tggcatgagtgtcttgatgtgcaatcatttgttgatctggtacattcaaccaatggtacc
acgcagagggaggacaattatggggttgagcaggatcatgaatcaaagaccattaggtcg
tcaagaaaacgagagaagaagaatgtctttgcagttccttctcattttgttcagactgac
gtgtctcgaattaagggtgaaacatcaatgttctctgacatggtgttttattttgctaat
gtgccttcatcacatacactagaatccttgcataaaatggttgttgagcatgggggtgct
ttctccatgaatttgaataagtcagttactcattgtatagcagctgaaagtagaggtatc
aagtttcaagctgcaaaacttcatggagatgttattcaatgctcttggctctttgactgc
tgtctgcaaaagaagctccttcctttacagccaaagtattttcttttcctttctgattca
acaaagaaaaagatggaagcagaagtggatgaatattctgattctttcttctccgacatc
agcattgaagaaattaaactgcttttgagaaatatagaacacccagaagactccaaaact
gtcgagtactacaagaaaaagtactgtcccaaggatgaatgggctcggtttcatggttgc
tgcatttattttttcataccaaagcagtgtctggaatattcagattgcaaggttttagtg
gaacttgctatgaagaggatgaaagttgaaatttctgttggtggtgggaaagttggtgac
aatctttttcatgccacccatgtcgtcgtcatgtctctaccagagatcgatgtaaagttc
aatgaagtgttaaatagtttctcagaggctgagaaacatgttttgtacaatacaaagctg
catgtagtcggagcacggtggttggaggattcccttaaagaggaccagaagttgcttgag
gagagttatagccttaagcctagcaattttcaaatgtcaatctctgagaagagtaggcat
gataagcaaaaaggtgattctgaaaagtgcaaaagaccatcttcccttgataaacatgga
ggacaaatcaaagcaaaaggaatttcagaccagggccgagctatcacactaccaaagagg
ggcaggaaacgagatagaggaagacctactggtagtgctacagcaaaagggaaagtgggg
atcaacattccacgtacagttaaacgcaaggtcacaagtagtcgtgctaagattcatgaa
aatgaatctgatgaaagtgctacttcatgtgagcatcttcgtaatgacgagggtgaagcg
gctgttgggagctatgaaactactgcagtacgtagctcaggagttcagaatgaggatgta
caggatctggaattgtcagaagatggtaaaacacttccaccagggactgctgaatgcagt
gtgatcaatgaaagattggacaaagctcacgaaacttcatatggaagtggaaatattgcc
aggggcaaagacaaggtggatgaaaagctggaagaccctgttgatccagtccaagctatg
ctattgcatatgataccccacttggatagtaagccaacaagaagcatagacactcttgta
aaagacgacaagccagatgcagatactaatcccagtcctaaaaagaaaaagaaaattagc
tataaagatgtagctggtgagttgctcaaagattggtga

DBGET integrated database retrieval system