KEGG   Solanum lycopersicum (tomato): 104648251
Entry
104648251         CDS       T02665                                 

Definition
(RefSeq) salutaridinol 7-O-acetyltransferase-like
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00940  Phenylpropanoid biosynthesis
sly00941  Flavonoid biosynthesis
sly00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    104648251
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    104648251
   00941 Flavonoid biosynthesis
    104648251
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     104648251
SSDB
Motif
Pfam: Transferase 2-oxoacid_dh
Other DBs
NCBI-GeneID: 104648251
NCBI-ProteinID: XP_010323479
UniProt: A0A3Q7H7I5
LinkDB
Position
7
AA seq 445 aa
MESKSLTKIQILSKNIIKSNHVNDVDHPNNYKLSFFDQFACQMHVPCFLFYPIKYSTSPK
ISIIHEQLQQSLSKLLSHVYPASGRFSSDAQSINCHDEGVLYIKAKVDSQFCDFLKDAQK
DIDLALNFCPKINRNDSNLSLTPLVVVQVTEFACGKGLALSLSAEHAVIDGFTALKFVYE
WSKVSKMGINKINCFTFDDFGTIFPPTSDNHLLKRVESPRDDHNHDFPEMVARRFVINQS
VISKLREHVGVVHIRPSRVELVIAFLWRALINVYRCKSNGRLRPCLLSVPVNLRGKIDFP
RYENSFGNFAIEVPVKFIPGETGMELKDILLLIKDVIQKTNVSFVKSSDNIYSLASKFHE
EIKEWEENEQVDVCMASSLCRFPINEADFGWGKPCLLSFGLRRSDMFWLYDTQCGSGIVL
QVDLKKEYMDMFGCDKDVLSFIFDE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggagtctaagtctcttacaaagattcaaatcctttccaaaaatatcataaaatcaaat
catgttaatgatgttgatcaccccaataattacaaattatctttctttgatcaatttgct
tgtcaaatgcatgtcccttgctttcttttctatccaatcaaatattccacctcccctaaa
atttccattatacatgaacaacttcaacaatcattgtccaagcttttaagtcatgtttat
ccagcatcaggtagattttcatctgatgctcaatctatcaattgtcatgatgaaggtgtt
ttgtatataaaggcaaaagttgattctcaattttgtgatttcctcaaggatgcacaaaaa
gatatcgacctagcattgaatttttgccctaaaatcaatcgtaacgattcgaatttgtct
ctcactccactagttgtagtgcaagtgacggagtttgcttgtggtaaggggctagcttta
tctctgagcgctgaacatgcggttattgatggattcacagcattgaaatttgtttacgag
tggtctaaagtgagtaaaatgggaattaataagatcaattgcttcacttttgatgatttt
ggtaccattttcccaccaacaagtgataatcatttgttaaaaagagtcgagtctcctaga
gatgatcataatcatgattttcctgaaatggtagcacggaggttcgtcataaatcaatca
gtgatatcaaaacttagggaacatgttggagtggttcatatcagaccatcacgagttgaa
ttggtgattgcttttctatggagggctctgatcaatgtttatcgatgtaaaagtaatgga
cgtttgagaccttgtttattgagcgtccctgtgaatttacgtggtaaaattgactttcca
agatacgaaaactcctttgggaattttgctattgaagtcccggtcaaattcatcccggga
gaaacaggaatggagttaaaagacattttactattgatcaaggacgtcatacaaaaaacc
aacgtatcatttgtgaaatctagtgataatatatattcgctagcatcaaagtttcatgaa
gaaataaaagaatgggaagaaaatgaacaagtggatgtgtgcatggcatcaagtttatgt
aggttccctattaatgaagctgattttggttggggtaaaccttgtttgctaagttttgga
ttgagacgtagtgatatgttttggttgtatgatacacaatgtgggagtggaattgttctt
caagtagatttgaagaaagaatacatggacatgtttggatgtgacaaagatgtattgtct
ttcatttttgatgagtag

DBGET integrated database retrieval system