KEGG   Solanum lycopersicum (tomato): 112940037Help
Entry
112940037         CDS       T02665                                 

Definition
(RefSeq) phosphopantothenate--cysteine ligase 2-like
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00770  Pantothenate and CoA biosynthesis
sly01100  Metabolic pathways
Module
sly_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    112940037
Enzymes [BR:sly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     112940037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP Stk19
Motif
Other DBs
NCBI-GeneID: 112940037
NCBI-ProteinID: XP_025886293
LinkDB All DBs
Position
4
AA seq 204 aa AA seqDB search
MDAVDDANQLQETPKNEVMSFFESTPLLEDAAEIEKSLKEFVDRNTSSSVNGKTNRVVCI
TSGGTTVPLEKQCVRYIDNFSSGHRGATSTEYFLKAGYSVVFLYRRGSCQPFCSTLPDDP
LLECFSVADDSSIEVDALHAETVKRAITESLTAVAEGILLKLPFTTIFEYLQFALWRLVA
LRLMFIWSLADSTANFCVFEGLRA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagttgatgatgctaatcagttacaagaaacaccaaaaaatgaagttatgtcc
ttcttcgagtcaactcctttactagaggatgctgctgaaattgagaaaagcttgaaggaa
ttcgttgatcgcaatacttcatcatcagtgaatggaaaaacaaacagggtagtatgtatt
acttcaggtggtacaactgttcctttggaaaagcaatgtgttcgctatattgacaacttt
agctctggtcatagaggggctacatccacagaatactttctgaaggccggttattctgta
gtctttctctaccgaagagggtcatgccaaccattttgtagtactctgcctgatgatccg
ctgctagagtgctttagtgttgctgatgattcaagtattgaagtggatgcattgcatgct
gaaacggtgaagagagcgattactgaaagtctcactgcagttgctgagggcatcctgttg
aaacttccatttacaacaattttcgagtatttgcagttcgctttgtggaggctggtagca
cttcgattaatgtttatttggtcactggcagattctacagctaatttctgtgtctttgag
ggacttcgggcctag

DBGET integrated database retrieval system