KEGG   Solanum lycopersicum (tomato): 543865Help
Entry
543865            CDS       T02665                                 

Gene name
PPCK2
Definition
(RefSeq) phosphoenolpyruvate carboxylase kinase 2
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Kdo Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 543865
NCBI-ProteinID: NP_001234304
UniProt: Q84JP7
LinkDB All DBs
Position
6
AA seq 278 aa AA seqDB search
MSESLKRNYCVGGELGRGRFGTVFKCYSSATGELFAVKSIDKRLIADDAIDRQCLYNEAK
IMHLLSPNPNVVRVFDIYEDDTHLDMVLELCNSGDLFQRLSSQPIFSESDAVDVMVPLMK
AIAHCHRLGVAHRDIKPDNILFTDSNELKLADFGSAECFHEGQLMSGVVGTPYYVAPEVL
AGRNYSEKIDIWSAGVILYIMLAGVPPFFGDSASEIFEAVLRANLRFPPRIFHSVSPAAK
DLLRRMLSKDVSRRFSAEQVLRHPWMTSNGEIRTVAPF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcactgaagcgaaattattgtgtgggtggagagttaggaaggggacgattc
ggcaccgttttcaagtgttactcgtcggcgaccggtgagctattcgccgtcaagtctatc
gacaagcgcctaatcgccgatgacgccatagatcgacaatgtctttacaacgaagcgaaa
attatgcacttgctttcgccaaatcctaatgttgttcgtgttttcgatatctacgaggac
gatactcaccttgatatggttttagagctctgcaactccggcgatttgttccaacgcctc
agtagtcaaccgattttctcagagtccgacgctgttgatgtcatggtaccactaatgaaa
gcaatagcgcactgtcaccgtctcggtgtagcccacagggacatcaaaccggataacatt
ttattcaccgactctaacgaactgaaattggctgattttggatcggcggagtgtttccat
gagggccagctgatgagcggcgtggttggaacgccgtattatgtggcgccagaggtttta
gctgggagaaactacagtgagaagatcgatatttggagtgctggtgttattctgtatata
atgcttgccggagttccacctttctttggtgactcagcttcagagatcttcgaggctgtg
ctcagagctaaccttaggtttccgcctaggatcttccattcagtatcgccggcggcgaag
gatttgcttcggagaatgctctctaaagacgtttctagaagattctctgccgaacaagtt
ctcaggcatccatggatgactagcaacggagaaatcagaacagttgctccattttag

DBGET integrated database retrieval system