KEGG   Solanum lycopersicum (tomato): 543981Help
Entry
543981            CDS       T02665                                 

Gene name
SODCP.2
Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sly00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    543981 (SODCP.2)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     543981 (SODCP.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 543981
NCBI-ProteinID: NP_001234769
UniProt: Q7XAV2
LinkDB All DBs
Structure
PDB: 

Position
11
AA seq 217 aa AA seqDB search
MAAHSIFTTTSTTNSFLYPISSSSSSPNINSSFHGVSLNVKSKFGQSLTLYAVTTPKPLT
VFAATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGC
MSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRAL
VVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccactcaatcttcaccacaaccagcactaccaattctttcttatacccaatt
tcttcttcttcttcttcccctaacattaactcttctttccatggtgtttcacttaatgtt
aagtcaaaatttggccaatctttgaccctttatgctgtcactacccctaaaccccttact
gtttttgctgctactaagaaagctgttgctgtccttaagggcaactctaatgttgagggg
gttgtcactctatctcaagatgatgatggtccaactacggttaatgttcgtataactgga
cttgctcctggacttcacgggtttcatttacatgaatatggtgacactacaaacggatgt
atgtctacaggagcccattttaatccgaataaattgacacatggagctcctggagatgaa
atccgtcatgcgggtgacctgggaaacatagtggccaatgccgatggcgtggctgaagtg
acacttgtagataatcagataccattgaccggtccaaactcagttgttggacgagcactt
gtggttcatgagcttgaggatgacctcggaaagggtggccatgaactcagtcttaccact
ggcaatgctggtggacgattggcatgcggtgtggttggtttgactccaatatga

DBGET integrated database retrieval system