KEGG   Solanum lycopersicum (tomato): 544313Help
Entry
544313            CDS       T02665                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00250  Alanine, aspartate and glutamate metabolism
sly00410  beta-Alanine metabolism
sly00430  Taurine and hypotaurine metabolism
sly00650  Butanoate metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Module
sly_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    544313
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    544313
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    544313
   00430 Taurine and hypotaurine metabolism
    544313
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     544313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 544313
NCBI-ProteinID: NP_001234041
UniProt: B1Q3F0
LinkDB All DBs
Position
3
AA seq 502 aa AA seqDB search
MVLTTTSIRDSEESLHCTFASRYVQEPLPKFKIPKKSMPKEAAYQIVNDELMLDGNPRLN
LASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAV
GVGTVGSSEAIMLAGLAFKRKWQSKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELK
EVKLKEGYYVMDPAKAVEIVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNKETGWET
PIHVDAASGGFIAPFLWPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPDE
LVFHINYLGSDQPTFTLNFSKGSYQIIAQYYQLIRLGFEGYKDVMKNCLSNAKVLTEGIT
KMGRFDIVSKDVGVPVVAFSLRDSSKYTVFEVSEHLRRFGWIVPAYTMPPDAEHIAVLRV
VIREDFSHSLAERLVSDIEKILSELDTQPPRLPTKAVRVTAEEVRDDKGDGLHHFHMDTV
ETQKDIIKHWRKIAGKKTSGVC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgttaacaacgacgtcgataagagattcagaagagagcttgcactgtacatttgca
tcaagatatgtacaggaacctttacctaagttcaaaatccctaaaaaatccatgccgaag
gaagcagcttatcagattgtaaacgacgagcttatgttggatggtaaccccaggttgaat
ttagcttcctttgttagcacatggatggagcccgagtgcgataagctcatcatgtcatcc
attaataaaaactatgtcgacatggatgagtatcctgtcaccactgaacttcaaaataga
tgtgttaacatgttagcacatcttttccatgccccggttggtgatgatgagactgcagtt
ggagttggtacagtgggttcatcagaggcaataatgcttgctggccttgctttcaaacgc
aaatggcaatcgaaaagaaaagcagaaggcaaacctttcgataagcctaatatagtcact
ggagctaatgtgcaggtctgctgggaaaaatttgcaaggtattttgaggttgagttgaag
gaggtgaaactaaaagaaggatactatgtaatggaccctgccaaagcagtagagatagtg
gatgagaatacaatatgtgttgctgcaatccttggttctactctgactggggagtttgag
gatgtgaagctcctaaacgagctccttacaaaaaagaacaaggaaaccggatgggagaca
ccgattcatgtcgatgctgcgagtggaggatttattgctcctttcctctggccagatctt
gaatgggatttccgtttgcctcttgtgaaaagtataaatgtcagcggtcacaagtatggc
cttgtatatgctggtgtcggttgggtgatatggcggagcaaggaagacttgcccgatgaa
ctcgtctttcatataaactaccttgggtctgatcagcctacttttactctcaacttctct
aaaggttcctatcaaataattgcacagtattatcagttaataagacttggctttgagggt
tataaggacgtcatgaagaattgcttatcaaacgcaaaagtactaacagagggaatcaca
aaaatggggcggttcgatattgtctctaaggatgtgggtgttcctgttgtagcattttct
ctcagggacagcagcaaatatacggtatttgaagtatctgagcatctcagaagatttgga
tggatcgtccctgcatacacaatgccaccggatgctgaacacattgctgtgctgcgggtt
gtcattagagaggatttcagccacagcctagctgagagacttgtttctgacattgagaaa
attctgtcagagttggacacacagcctcctcgtttgcccaccaaagctgtccgtgtcact
gctgaggaagtgcgtgatgacaagggtgatgggcttcatcattttcacatggatactgta
gagactcagaaagacattatcaaacattggaggaaaatcgcagggaagaagaccagcgga
gtctgctag

DBGET integrated database retrieval system