KEGG   Solanum lycopersicum (tomato): 778210Help
Entry
778210            CDS       T02665                                 

Gene name
HXK3
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00051  Fructose and mannose metabolism
sly00052  Galactose metabolism
sly00500  Starch and sucrose metabolism
sly00520  Amino sugar and nucleotide sugar metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
Module
sly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sly_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    778210 (HXK3)
   00051 Fructose and mannose metabolism
    778210 (HXK3)
   00052 Galactose metabolism
    778210 (HXK3)
   00500 Starch and sucrose metabolism
    778210 (HXK3)
   00520 Amino sugar and nucleotide sugar metabolism
    778210 (HXK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    778210 (HXK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sly04131]
    778210 (HXK3)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     778210 (HXK3)
Membrane trafficking [BR:sly04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    778210 (HXK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 778210
NCBI-ProteinID: NP_001234710
UniProt: Q4PS97
LinkDB All DBs
Position
12
AA seq 499 aa AA seqDB search
MGKLVVGATVVCTAAVVCGVTVLLMKHRVKNSGEWGKVEALLKDFEEKCATPVEKLKQVA
DAMTVEMQAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKEK
RIVKHEVKEVSIPQNVMTGSSSEVLFDFIATALAEFVATEGDDFHLPPGRQRELGFTFSF
PVKQLSIASGTLIKWTKGFSIEDLVGQDVVGELAKAMERAGLDVRVAALVNDTVGTLAGG
RYNNPDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPVTEY
DQNLDIESLNPGEQIYEKIISGMYLGEILRRVLCRMAEEASLFGDYVPSKLKVPFVLRTP
DMAAMHHDESADLKVVGNKLKDILEVPNSTLKMRKIVVELCDIITSRGARLSAAGIVGIL
KKLGRDTFKDGEKQRSVIAVDGALFEHYTKFRNCLKETMKELLGDAADSTVIELSNDGSG
VGAALLAASHSQYTDLEES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattggttgtaggtgcaacagttgtgtgtactgctgctgtagtatgtggggtg
acagttttgttaatgaaacatagggtgaagaattctggggagtggggaaaagttgaagct
ttattgaaagattttgaggagaagtgtgcaactccagtggaaaaattaaagcaggtagct
gatgctatgactgtagagatgcaagctggacttgcttctgaaggtgggagtaagctcaag
atgcttattagctatgttgataaccttcctactggggatgaaaaaggtctgttttatgca
ttggatctaggcggcacaaactttcgagtgatgcgtgtacagttgggtgggaaagaaaag
cgtatagttaaacatgaagttaaagaagtttcaattccacagaatgtgatgactggatca
tcatctgaagtgttatttgattttattgccacggcacttgcagaatttgtagctacagaa
ggtgatgattttcatcttccacctggtagacaaagggagttaggctttaccttctctttc
cctgtgaaacaattgtcaattgcatcaggaactcttattaaatggacaaagggcttctcc
atagaagatttggttgggcaagatgtggttggagaattagcaaaagcaatggaaagggcc
ggccttgacgtgcgtgtggctgcattagtaaatgatactgttggaacgttagcgggaggt
cggtacaataatcctgatgtcattgctgcagtaattttgggtaccggaaccaatgcagca
tatgttgaacgggctcatgcgattcccaaatggcatggtctgttgcctaaatccggagaa
atggttatcaacatggaatggggtaatttccgctcatcacatcttccagtaacagaatat
gaccaaaatcttgatattgagagtttaaaccccggtgagcagatttatgaaaagattatt
tccgggatgtatcttggagaaattttgcgtagagtattgtgtagaatggctgaagaagct
tcattattcggtgattatgtcccatccaaactgaaagttcctttcgtattgaggactccg
gacatggctgctatgcatcacgacgagtctgctgatctcaaggttgttggaaataagctg
aaggatatcttagaggtacctaattctaccttgaaaatgaggaaaatagttgtggagctg
tgcgatattatcacctctcgtggagctcgtctttctgcagcaggaattgtgggcatcctc
aagaaattgggaagagacacttttaaagacggagagaagcagaggtctgtcatagctgtg
gacggtgcattgtttgagcattacaccaagttcagaaattgcttgaaggaaactatgaaa
gagttactgggagatgctgcagatagcacagtcattgagctttctaatgatggttcaggc
gttggagctgcacttttggctgcctcacattcccaatacacagatctcgaggaatcttga

DBGET integrated database retrieval system