KEGG   Staphylococcus lutrae: B5P37_00365Help
Entry
B5P37_00365       CDS       T04991                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
slz  Staphylococcus lutrae
Pathway
slz00061  Fatty acid biosynthesis
slz00620  Pyruvate metabolism
slz00640  Propanoate metabolism
slz01100  Metabolic pathways
slz01110  Biosynthesis of secondary metabolites
slz01120  Microbial metabolism in diverse environments
slz01130  Biosynthesis of antibiotics
slz01200  Carbon metabolism
slz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:slz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5P37_00365
   00640 Propanoate metabolism
    B5P37_00365
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B5P37_00365
Enzymes [BR:slz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     B5P37_00365
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     B5P37_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp RimK ATPgrasp_ST GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ARJ49912
UniProt: A0A1W6BJ61
LinkDB All DBs
Position
complement(65248..66618)
Genome map
AA seq 456 aa AA seqDB search
MFRVLVANRGEIAVRIIRALREMKMESVAIYAVGDENSLHVKLADHAVCIGEANPLDSYL
NIRKILAAAEMTHANAIHPGYGFLSESPVFAEKVENEGLYFIGPTKETMQCMGDKISARQ
TVDAAGVPIIPGSKSAVETVDDIKSLADILGYPLVIKAASGGGGKGIRIVKEESQLERAF
KEAKREGNKYFNDDRIYVEAFIPVAKHVEVQVLGDGQDRFIHLGERDCSVQRKNQKLIEE
SPCSALSSDKRRKICNDAVKVAKAAKYRSAGTIEFLVTDDAYYFIEMNTRIQVEHTVTEM
RTNIDLVCEQLRLMQNGTLSLTQDDITFDGHVIEARINAEDPQKNFRPTPGTVKALHLPQ
GFNVRVDSLLYSGYTVSSYYDSLVAKVIVKGANRSHAIDKLKVTLDELVIDGFITTADFL
YAVLSYPPYFEGDAKDVDIKFLDRHTIIKEENTNAN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgtattagtcgcaaatcgaggagaaattgctgtgcgcattattcgagcgcta
agagaaatgaagatggagtctgtagccatctatgcagttggtgatgaaaatagtttacac
gttaaattggctgaccatgcagtttgtattggcgaagcaaacccgttagatagttatttg
aatatccgaaagattttagcggcagctgagatgacacatgcaaatgcgattcatccaggt
tatggctttttatcagaaagtccggtgtttgcagaaaaagttgaaaatgaaggcctctat
tttattggtccgacaaaagagacgatgcaatgcatgggagataaaatttctgcaagacaa
actgttgatgcggcaggcgttcctattattccaggttcgaaatctgcagtagaaacagtt
gacgatataaaatctttagcagacatacttggctatcctttagtaattaaagcggccagt
gggggtggcggaaaagggattcgaattgtaaaagaagaatcacaactcgaacgcgccttt
aaagaagcaaagcgcgaaggtaacaagtactttaatgatgatcgtatttatgttgaagct
tttatcccagttgcaaaacatgttgaggttcaagtgcttggtgatggacaagatcgattt
attcatctcggtgaacgagattgttctgtacaaaggaaaaaccaaaaattaattgaagaa
tctccatgtagcgcattaagttcagacaagcgaagaaaaatatgtaatgatgcagtcaaa
gtggcgaaagccgcaaagtatcgaagtgctgggacgattgaatttttagtgacagatgat
gcgtactattttattgagatgaatacgagaatccaagtggaacatactgtaactgaaatg
cgtacaaatattgatctcgtctgtgaacagttacgacttatgcaaaatggtacgctgtca
cttacacaagatgatattacgtttgatggtcacgtgatcgaggcgagaatcaatgcggag
gatcctcaaaaaaatttccgtccaacgccggggactgtgaaagctttacatttacctcaa
ggttttaatgttcgcgtcgattctttgctgtacagtggctatactgtttcctcttattat
gactcactagtcgccaaagtgattgttaaaggggcaaatcgttcgcatgccattgacaaa
cttaaagtcactttagacgagctggtcattgatggatttataacgactgcagattttcta
tatgctgtactctcgtatccgccatattttgaaggtgatgctaaagacgttgacatcaaa
tttttggaccgccacacaatcataaaggaggaaaacacaaatgcaaattga

DBGET integrated database retrieval system