KEGG   Staphylococcus lutrae: B5P37_02620Help
Entry
B5P37_02620       CDS       T04991                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
slz  Staphylococcus lutrae
Pathway
slz00010  Glycolysis / Gluconeogenesis
slz00053  Ascorbate and aldarate metabolism
slz00071  Fatty acid degradation
slz00280  Valine, leucine and isoleucine degradation
slz00310  Lysine degradation
slz00330  Arginine and proline metabolism
slz00340  Histidine metabolism
slz00380  Tryptophan metabolism
slz00410  beta-Alanine metabolism
slz00561  Glycerolipid metabolism
slz00620  Pyruvate metabolism
slz00625  Chloroalkane and chloroalkene degradation
slz01100  Metabolic pathways
slz01110  Biosynthesis of secondary metabolites
slz01120  Microbial metabolism in diverse environments
slz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5P37_02620
   00053 Ascorbate and aldarate metabolism
    B5P37_02620
   00620 Pyruvate metabolism
    B5P37_02620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5P37_02620
   00561 Glycerolipid metabolism
    B5P37_02620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5P37_02620
   00310 Lysine degradation
    B5P37_02620
   00330 Arginine and proline metabolism
    B5P37_02620
   00340 Histidine metabolism
    B5P37_02620
   00380 Tryptophan metabolism
    B5P37_02620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5P37_02620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5P37_02620
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B5P37_02620
Enzymes [BR:slz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B5P37_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh FlgI
Motif
Other DBs
NCBI-ProteinID: ARJ50287
UniProt: A0A1W6BK27
LinkDB All DBs
Position
complement(517539..518972)
Genome map
AA seq 477 aa AA seqDB search
MRDQTKQFINGEWVESHSGETIDVINPATEEVIGRIAKGDQADVDRAVQAAHDVYLSFRH
TSVETRQALLDRIVKEYENRKADLIEAITLELGAPVTKSEMVHYQMGLKHFQAARDALND
MRFEERRGKNLILKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVILKPSEMTPFAAI
ILAEIFEKAGVPKGVFNLVNGDGEGVGTPLSEHPDVRMMSFTGSGPTGTKIMEKASQDFK
KVSLELGGKSPFIILEDADIEEAAKAAVMKVVNNTGQVCTAGTRTLIPESFKDAFIAEAK
KQMAQVKVGDPQKSETQVGPLVSEKQFNQVQSYIQKGIDEGATLYYGGPGKPEGLDKGYF
AKPTIFVDVDNAMTIAQEEIFGPVMSVITYKDLDEAIAIANDTKYGLAGYVFGKNRDDLI
RVARSVEAGTIEINEAGRAADLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYYEGE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagagatcaaacaaaacaatttatcaatggggaatgggttgaaagtcatagtggagaa
acgattgacgtgattaatccagccacagaagaagttatcggtcgaattgcaaaaggtgat
caagcggacgtagatcgtgcggttcaagcggcacatgatgtctatctttcatttcgtcac
acttctgttgaaacacgtcaagctttactagaccgtatcgtaaaagaatatgaaaatcgt
aaagccgatttaatagaagccattactttagaacttggcgcaccagtaacaaaatctgaa
atggttcattatcaaatgggattgaaacattttcaggcagcacgtgatgcacttaacgac
atgcgttttgaagaacgccgtggtaaaaatttaattttgaaagaagccattggtgttgca
ggattagtcacaccgtggaacttcccaacgaaccaaacatcattaaaactcgcagcagca
tttgcagcgggaagtccagttatactcaaaccttctgagatgacgccatttgctgccatc
atattagcagagatatttgaaaaagccggtgttcctaaaggtgtatttaatttagtgaat
ggtgacggtgaaggtgtaggtacaccactgagcgaacatccagatgtacgtatgatgtca
tttacaggttcaggcccaacaggtacaaaaatcatggagaaagcgagtcaagattttaaa
aaggtttctcttgaattaggtggaaaatcgcctttcatcatattagaagatgctgatatt
gaagaagccgcgaaggcagcagtcatgaaagtggtcaacaacacgggacaagtttgtact
gctggtacacggacattgatacctgaaagctttaaggatgcctttattgctgaagcgaaa
aagcaaatggcgcaagtgaaagtaggagacccacaaaagagtgagacacaagttggaccg
ttagtaagtgagaaacaattcaatcaagttcaatcctatattcaaaaaggaattgatgaa
ggcgcaacgctatactatggtggaccaggaaaacctgagggtctagataaaggttatttt
gcaaaacctacaatttttgtcgatgtagataatgcaatgacgattgcgcaagaagagatt
tttggtcctgttatgtcggttatcacttacaaagatttagatgaagccattgcgattgct
aatgatacaaaatatggtctggcaggctatgtatttggaaaaaacagagacgatttaatt
cgtgttgcacgctcggttgaagccggaacaatagagattaatgaggcaggtcgagcagcg
gatttaccgttcggtggttacaagcaatctggacttggtcgtgaatggggagattatgga
attgaagaatttttagaagtgaaatctatagcaggttactatgaaggtgaataa

DBGET integrated database retrieval system