KEGG   Staphylococcus lutrae: B5P37_06225Help
Entry
B5P37_06225       CDS       T04991                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slz  Staphylococcus lutrae
Brite
KEGG Orthology (KO) [BR:slz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B5P37_06225
Enzymes [BR:slz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B5P37_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like Thioredoxin_3 FAD_oxidored GIDA Thi4 DAO AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ARJ50944
UniProt: A0A1W6BME4
LinkDB All DBs
Position
complement(1357761..1359284)
Genome map
AA seq 507 aa AA seqDB search
MLNQELKQQLSQLLDLMEGDVVLKVSTGEDAHSQKVNDLVNEVSGMSSHITVEQVELKRT
PSFSINRPNEDTGITFAGVPLGHEFNSFVLALLQVSGRAPKETQSVIDQIKSIDEPLHFE
TFISLTCQKCPDVVQALNLMSVLNPNITHTMIDGAVFKKEAEDIMAVPSIFLNGASFGSG
RMTVTDILSALGQGPDASKFEGKETFDVLVVGGGPASASSAIYAARKGLKTGIVADRIGG
QVNDTADIENLIGVKKTTGPSLATHLEAHIKDYQVDIMTGVRADALNKVDDTIHLTLDNG
ATLQTRSLIIGTGARWRKLGVPGEDTFANKGVAYCPHCDGPLFEGKDVAVIGGGNSGVEA
AIDLAGICKSVTVLEFGEALRADSVLQERLKSLNNTSVITQAATKEITGDDRVNGLTYTD
RATNEEKHIELNGVFVQIGLSPNTEWLGNTVQRNRMGEIEVDRLGHTNIPGVFAAGDCTD
QRYKQIIISMGSGATAALSAFDYLIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcaagaattaaaacagcaattgtcacaacttcttgatttgatggaaggtgac
gtcgtactgaaagtgagcactggagaggatgcacattctcaaaaggtaaacgaccttgtc
aatgaggtttcaggcatgtcatctcatattacagtagagcaagtagaattaaagcggaca
ccaagctttagtatcaatcgaccaaacgaggacactggcattacttttgctggtgtccct
cttggtcatgagttcaattcttttgtgctagcattgctacaagtgagtggtcgtgcgcca
aaagaaacgcaatctgtaatcgatcaaatcaaatctatagatgaaccgctccattttgaa
acatttatcagcttaacgtgtcaaaaatgtccggacgtggttcaagcgttaaacttaatg
agtgttttaaacccaaatattacacatacaatgattgacggagcggtattcaaaaaagaa
gctgaagatatcatggctgttccttctattttcttaaatggggcatcctttggtagtgga
cgtatgacagtaaccgacattcttagcgcgttgggtcaaggtccagatgcatccaaattt
gaaggaaaagaaacgtttgatgtgcttgttgttggtggtggccctgcgagtgcaagttct
gccatttatgctgcacgaaaaggtttgaaaacaggtatcgttgccgatagaatcggtggt
caagtgaacgataccgctgatattgagaatttaattggcgtgaagaaaacaacagggcca
tcattagccacgcatctcgaagcgcatataaaagattatcaagtggacatcatgaccggt
gtacgtgcagatgcattaaacaaagtagatgacacgattcatctgacgttagataatggc
gcaacccttcaaacacgttcactcatcattggcactggggcgcgttggagaaaactcggc
gtaccaggcgaagatacatttgctaacaaaggtgtggcatactgcccgcactgtgacggc
cctctttttgaaggaaaagatgtcgctgttatcggcggtggcaactcaggtgtagaagca
gcaatcgacttagccggcatatgtaaaagtgtcactgttcttgaatttggcgaagcactc
agagcagactctgtactacaggaacgtttgaaatccttaaacaatacatcggttattaca
caagcggcaacaaaagaaattacaggtgatgaccgtgttaatggactgacgtatactgac
cgtgcaacaaatgaagaaaaacatatcgaactcaatggcgtgttcgtccaaatcggactg
tcaccgaatacggaatggttaggcaacactgtacagcgcaatcgcatgggtgaaattgag
gttgatcgtcttggtcacacgaacatcccaggtgtgtttgccgcaggagattgtacagat
caacgctacaaacaaatcatcatttcaatgggttcaggtgcaactgctgcattatccgct
tttgattacttgattcgtcattaa

DBGET integrated database retrieval system