KEGG   Staphylococcus lutrae: B5P37_09540Help
Entry
B5P37_09540       CDS       T04991                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slz  Staphylococcus lutrae
Pathway
slz00010  Glycolysis / Gluconeogenesis
slz00020  Citrate cycle (TCA cycle)
slz00620  Pyruvate metabolism
slz01100  Metabolic pathways
slz01110  Biosynthesis of secondary metabolites
slz01120  Microbial metabolism in diverse environments
slz01130  Biosynthesis of antibiotics
slz01200  Carbon metabolism
Module
slz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5P37_09540
   00020 Citrate cycle (TCA cycle)
    B5P37_09540
   00620 Pyruvate metabolism
    B5P37_09540
Enzymes [BR:slz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B5P37_09540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H FAD-oxidase_C ATP-synt_ab_Xtn RnfC_N DUF896 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ARJ51534
UniProt: A0A1W6BP32
LinkDB All DBs
Position
2054379..2055674
Genome map
AA seq 431 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDILCEVQNDKSVVEIPSPVSGTVLEVL
VDEGTVSVVGDVIVKIDAPDAEEMEFKGGHHDNASEKAEEAPKEEVKQEAAPATQEAVEV
DENRQIKAMPSVRKYARDNQVNIKAVNGTGKNGRITKEDVDAYLNGGGQEVTSAQETAST
DSSEGSAATTAAISTEGDFPETTEKISAMRKAIAKAMVNSKHTAPHVTLMDEIDVQELWD
HRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIAAD
TERGLLVPVIKHADRKSMFQISDEINELAVKAREGKLTSDEMKGATCTISNIGSAGGQWF
TPVINHPEVAILGIGRIAQKPIVKDGEIIAAPVLALSLSFDHRQIDGATGQNAMNHIKRL
LNNPELLLMEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggtgaaggtatccacgaaggtgaaatcgta
aagtggtttgttaaggctggggatacgattgaagaagacgatatactatgtgaagtgcaa
aacgataaatcagttgtagaaatcccatctcctgttagtggtacagttctggaggtatta
gtggacgaaggaacagtttcagttgtgggggacgtcattgtaaaaattgatgcaccagac
gcagaagaaatggaatttaaaggtggacatcacgataatgcgtcagaaaaagcggaagaa
gcccctaaagaagaagttaaacaagaggctgcaccagcaactcaagaagcagtagaagtt
gatgagaatagacaaatcaaagcgatgccgtcagtgcgtaaatatgcacgtgacaatcaa
gtcaacattaaagctgtaaatggtacaggtaaaaatggtagaattactaaagaagatgta
gatgcatacttaaatggcggtggacaagaagtgacatccgcgcaagagactgcatcaaca
gattcttcagaaggatcagcggcaacgacagcagcgatttcgactgaaggtgacttccca
gaaacaacagaaaaaatctcagcgatgcgtaaggcaattgctaaggcaatggtaaactct
aaacatactgcacctcacgtgactttaatggacgaaatcgatgttcaagaattatgggat
caccgtaagaaatttaaagaaattgctgcagaacaaggtacaaaattgactttcttacct
tatgtggttaaagcattagtttctgcattgaaaaaatatccagcactgaacacatcattc
aacgaagaagctggtgaagtggttcataagcactactggaatatcggtattgctgcagat
acagaaagaggtttgttagttccagtgattaaacacgctgatcgtaaatcaatgttccaa
atctcagatgaaattaacgaattggctgtaaaagcacgtgaaggtaaattaacttctgat
gaaatgaaaggtgcaacatgtacaattagtaacatcggttcagcaggtggtcaatggttt
acaccagttattaatcacccagaagttgcaattttgggtattggccgtattgcacaaaaa
cctatcgttaaagatggcgaaatcattgcagcaccagtgttagcattgtcattaagcttt
gaccatagacaaattgatggcgcaacaggtcaaaatgcaatgaatcacattaaacgtcta
ttaaacaatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system