KEGG   Streptomyces avermitilis: SAVERM_1952Help
Entry
SAVERM_1952       CDS       T00126                                 

Definition
(GenBank) putative aminotransferase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAC69663
NITE: SAV1952
UniProt: Q82LQ8
LinkDB All DBs
Position
complement(2388408..2389688)
Genome map
AA seq 426 aa AA seqDB search
MSDLYGRHRSVLPDWLALYYADPIEITHGEGRHVWDAAGNRYLDFFGGILTTMTAHALPE
ITKAVSEQAGRIVHSSTLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEANDTALLLAT
TYRQSNQILAMRNSYHGRSFSAVGITGNKGWSPTSLSPLQTLYVHGGVRTRGPYAELGDA
DFIAACVEDLKDLLGHIRPPAALIAEPVQGVGGFTAPPDGLYAAFREVLQEQGILWIADE
VQTGWGRTGEHFWGWQAHGQSGPPDILTFAKGIGNGMSIGGVVARADIMNCLDANSISTF
GGTQITMAAGLANLIYLLEHDLQGNARRVGGLLIERLRAIGAQLPVVREVRGRGLMIGIE
LVKPGTDEANPQAASAVLEAAREAGLLLGKGGAHNTSALRIAPPLSLTVAEAEEGAAILD
RALRSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacctgtacgggcgtcaccggtccgtcctgcccgactggctcgcgctctactac
gcggacccgatcgagatcacccacggcgagggccgccacgtctgggacgcggcaggcaac
aggtatctcgacttcttcggcggcatcctcaccaccatgaccgcgcacgcgctgcccgag
atcaccaaggcggtgagcgagcaggccgggcggatcgtccactcctcgaccctctacctc
aaccggccgatggtcgaactcgcggagcggatcgcccagttgtcgggcatcccggacgcc
cgggtcttcttcaccacgtccggcaccgaggccaacgacaccgcgctgctgctggcgacg
acgtaccggcagagcaaccagatcctggcgatgcgcaacagctaccacggccgctcgttc
agcgcggtcggcatcaccggcaacaagggctggtcgcccacctcgctgtcacccctgcag
acgctgtacgtgcacggtggcgtccgcacccgcggcccgtacgccgaactcggcgacgcc
gacttcatcgcggcctgcgtggaggacctgaaggacctgctcggccacatccgcccgccc
gccgccctgatcgccgaacccgtccagggcgtcggcggcttcaccgcaccgcccgacggg
ctgtacgcggccttccgggaggtactccaggagcagggcatcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcacacgggcag
agcggcccgccggacatcctcaccttcgccaagggcatcggcaacggcatgtccatcggt
ggcgtcgtcgcccgcgccgacatcatgaactgcctggacgccaactccatttcgaccttc
ggcggcacccagatcaccatggcggccggcctcgccaacctcatctacctcctcgaacac
gatctccagggcaatgcccggcgcgtgggcggcctgctcatcgagcggctgcgggccatc
ggcgcgcagcttcccgtcgtacgggaggtgcgtgggcgcgggctcatgatcggcatcgag
ctggtcaagcccggcaccgacgaggcgaacccgcaggcggcgtccgccgtgctcgaagcc
gcccgtgaggcgggcctgctgctcggcaagggcggcgcccacaacaccagcgcgctgcgc
atcgccccgccgctctcgctcaccgtcgccgaggcggaagagggcgccgcgatcctcgac
cgcgccctgaggagtgtctga

DBGET integrated database retrieval system