KEGG   Streptomyces avermitilis: SAVERM_1p90Help
Entry
SAVERM_1p90       CDS       T00126                                 

Gene name
lig
Definition
(GenBank) putative ATP-dependent DNA ligase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: BAC75374
UniProt: Q82Y91
LinkDB All DBs
Position
SAP1:complement(85072..86049)
Genome map
AA seq 325 aa AA seqDB search
MTWTLPEPMLSTPVPKPELRPGWAGEPKWDGFRAGVSVNAGRVVLRSRRGTEMGPAFPEV
VAGAVQLSEATALDGELVVWDAAGRLAFERLQNRLARRGAGAARAAEEWPAHFVAFDLLR
LSGTDTTRWPYQRRRAALESVFASRRLSAPWALCPSTTEADVVREWLTWASVGMEGVVFK
RLDDAYRPSVRGWQKYKVRETSEAIVGAVTGSPASPRTLLLGRYDDQGRLQYVGRTTTLA
RTAGAAVAGLLAPARRGHPWTGWSFSAGWGTRETLNVTLVEPELVAEVGVDVARDTSGRW
RHPARWHRARPDLSPADIPHLTSPL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtggacgctgccggagccgatgctgagcactcccgtacccaagcctgaactgcgg
ccgggctgggcgggcgagccgaagtgggacgggttccgggcaggggtctccgtcaacgcg
ggccgggtggtgctgcgctccaggcggggcacggaaatggggccggcgttcccggaggtt
gtggccggggctgtgcagctgtcggaagcgaccgcgctggacggcgagctggtcgtatgg
gacgccgcgggccgcctcgcgttcgagcggttgcagaaccggcttgcccggcgcggtgcc
ggggcggcccgggccgcggaggagtggccggcccacttcgtcgcgttcgatctgctacgg
ctgtccgggacggacacgaccaggtggccgtaccagcggcgcagggccgcgctggagtct
gtgttcgcctcccgccggctgtcggcgccgtgggcgctgtgcccgtcgaccaccgaggct
gatgtcgtgcgcgagtggctgacgtgggcgtcggtcggcatggagggggtggtcttcaag
aggttggacgacgcctaccgcccgtcggtgaggggctggcagaaatacaaggtccgcgag
acgagcgaggcgatcgtcggcgcggtcaccggctccccggcctctccccgcacgctgctg
ctcggcaggtacgacgaccaaggccgccttcagtacgtcggccgcaccaccaccctcgcc
cggacggcaggtgctgcggtcgccggcctgctcgctccggcgcggcgcggtcatccctgg
acgggctggtctttctccgccgggtggggcaccagggagacgctgaacgtcacgctggta
gaacccgagctggtggcggaagtcggcgtcgacgtcgcccgtgacacctccggccggtgg
cgccaccccgcacgctggcaccgcgcccgccccgacctctcccccgccgacatcccccac
ctgacatcgccgctctga

DBGET integrated database retrieval system