KEGG   Streptomyces avermitilis: SAVERM_2295Help
Entry
SAVERM_2295       CDS       T00126                                 

Gene name
fabI2
Definition
(GenBank) putative enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00061  Fatty acid biosynthesis
sma00780  Biotin metabolism
sma01100  Metabolic pathways
sma01130  Biosynthesis of antibiotics
sma01212  Fatty acid metabolism
Module
sma_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAVERM_2295 (fabI2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAVERM_2295 (fabI2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAVERM_2295 (fabI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_2295 (fabI2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAVERM_2295 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAVERM_2295 (fabI2)
Lipid biosynthesis proteins [BR:sma01004]
 Fatty acid synthase
  Component type
   SAVERM_2295 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: BAC70006
NITE: SAV2295
UniProt: Q82KS7
LinkDB All DBs
Position
complement(2797311..2798093)
Genome map
AA seq 260 aa AA seqDB search
MSGVLAGKRILVTGVVTEASIAFHVARLAQEEGAEVVLTGFGRLSLIERIAARLPKPVPV
IELDVTDQAHLDTLADRIRESVDGADEHYGLDGVVHSIAYGPQGAFSFLDGDWADVSTAV
QVSAYSLKSLTTACLPLLERRGGSVVGLTFDATVAWPHYDWMGVAKAALESTSRYLARDL
GGRGIRCNLVAAGPLRSMAAKSIPGFGELAEVWQHRAPIGWDLVDPDPAARGVVALLSDF
FPRTTGEIVHVDGGVHMMGA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagttctcgccggtaagcgcatcctggtgacgggcgtcgtcacggaggcgtcc
atcgccttccacgtcgcccggctcgcgcaggaggagggcgccgaggtcgtactgaccggc
ttcggccggctctccctgatcgagcggatcgccgcccggctgcccaagccggtcccggtg
atcgagctggacgtcaccgaccaggcgcacctggacacgctcgcggaccggatccgcgag
tccgtcgacggcgccgacgaacactacggtctcgacggggtggtgcactccatcgcgtac
gggccgcagggcgccttctccttcctcgacggcgactgggcggacgtctcgacggccgtg
caggtgtcggcgtactccctgaagtccctgaccaccgcgtgcctgcccctgctggagcgg
cgcggcggttcggtggtcgggctcaccttcgacgcgacggtcgcctggccgcactacgac
tggatgggcgtcgccaaggccgccctcgagtcgaccagccgctatctcgcccgcgacctg
ggcggccgcggcatccgctgcaacctggtcgcggccggtccgctgcgctccatggccgcc
aagtcgattcccggcttcggggaactcgcggaggtctggcagcaccgggccccgatcggc
tgggacctcgtcgacccggaccccgccgcacgcggagtggtcgcactgctgtccgacttc
ttcccgcgcaccaccggcgagatcgtccacgtggacggcggagtgcacatgatgggggcg
tga

DBGET integrated database retrieval system