KEGG   Streptomyces avermitilis: SAVERM_2383
Entry
SAVERM_2383       CDS       T00126                                 

Gene name
pks9-5
Definition
(GenBank) putative aromatase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma01056  Biosynthesis of type II polyketide backbone
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SAVERM_2383 (pks9-5)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SAVERM_2383 (pks9-5)
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: BAC70094
NITE: SAV2383
UniProt: Q79ZE7
LinkDB
Position
complement(2908487..2909455)
AA seq 322 aa
MTTLVRCLVVSSTQRRVDHAITIEGDVETVFDLIADIARWPQFHRSAVHAETVHANEKGE
LVRHWALAGDAAVRAWQTVRRTDRPGRRITFAHMEPEQPATDLRGEWVFTELTPNRTRVE
LSHQVVAPTGADLGPLLDRIAQESEDCLATLRDTAERRADLDELVVSFTDPLFIAGSVED
AYDYLYRADLWPERIPHVVGLAMTEDVPNVQFFDMDTKGPDGSTHTVRSVRICLPNHLIV
YKQISLPTMLDAHTGHWRFTETPEGVIAEARHTSTIKRSALSQLGGATTVAEARRYLRRL
LSGNSMSNLRLAKAYAEERAGF
NT seq 969 nt   +upstreamnt  +downstreamnt
gtgacgacgcttgtgaggtgtcttgttgtgtcgagtacacagcggcgagttgaccacgcc
atcaccatcgagggcgacgtggagacggtgttcgacctgatcgcggacatcgcgcgatgg
ccgcagttccaccggtccgcggtgcacgcggagacggtccacgccaacgagaagggagag
ttggtcaggcactgggctctggccggtgacgccgccgtccgcgcctggcagaccgtgcgc
cgcacggaccggccggggcgccgcatcaccttcgcgcacatggaacccgaacagcccgcc
accgacctccgcggcgagtgggtcttcaccgaactgacgccgaaccggacccgggtcgag
ctgagccaccaggtcgtcgcgccgaccggcgccgatctcggcccgttgctggacaggatc
gcgcaggagagcgaggactgcctcgccacgctccgcgacacggccgagcgccgggccgac
ctggacgaactcgtcgtgtccttcactgacccgctgttcatcgccggctccgtcgaggac
gcctatgactacctctaccgggcggacctgtggcccgagcgcatcccgcacgtggtgggg
ctcgccatgaccgaggacgtgccgaacgtccagttcttcgacatggacaccaagggtccg
gacggcagcacgcacaccgtccgctcggtgcggatctgcctcccgaaccacctgatcgtg
tacaagcagatctcgctgcccacgatgctggacgcgcacaccggccactggcggttcacc
gagacgccggaaggcgtcatcgccgaggcccggcacaccagcacgatcaagcgctcggcg
ctgtcccagctgggcggcgcgacgacggtcgccgaggcgcgccggtacctgcgacggctg
ctgagcggcaacagcatgagcaacctccgcctcgccaaggcgtacgcggaggagcgcgcc
ggcttctga

DBGET integrated database retrieval system