KEGG   Streptomyces avermitilis: SAVERM_2946Help
Entry
SAVERM_2946       CDS       T00126                                 

Gene name
ligD
Definition
(GenBank) putative DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SAVERM_2946 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2946 (ligD)
Enzymes [BR:sma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SAVERM_2946 (ligD)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SAVERM_2946 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAC70657
NITE: SAV2946
UniProt: Q82J36
LinkDB All DBs
Position
3694892..3695773
Genome map
AA seq 293 aa AA seqDB search
MTPITEVAGRRLALSNLEKVIYPATGFTKGEVLHYYATTADALLAHLHDRPISFLRYPDG
PDGQVFFAKNVPPGTPDWVVTAEVPRSEGPARMVLVQDLASLMWAANLVTEFHTHQWRIG
TPGQADRLVFDLDPGPPATIVECCEVALWLRERLAADGIESYAKTSGSKGLHLLAALEPT
PSGRATEYAKELAVAAEKDMPRLVLHRMTRSLRPGKVFVDWSQNAARKTTAAPYTLRARA
EPTVSTPVTWEEVADCTAARPLAFQAPDIAPRLQEHGDLLAPLLDPGHAAPLP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatcacggaggtggcggggcgacggctggccctctccaacctggagaaggtc
atctatccggcgaccggcttcaccaagggcgaggtgctgcactactacgccaccaccgcc
gacgccctcctggcgcacctgcacgaccgtccgatctccttcctgcgctaccccgacggc
ccggacggtcaggtcttcttcgccaagaacgtgccgccgggtacgcccgactgggtcgtc
accgccgaggtgccccgttcggaggggcccgcccgcatggtcctggtccaggacctggcg
agcctgatgtgggcggcgaacctggtgaccgagttccacacccaccagtggcggatcggc
acgcccggccaggcggaccggctcgtcttcgacctcgacccgggcccgcccgcgacgatc
gtcgagtgctgtgaggtcgcgctgtggctgcgggagcggctggcggcggacgggatcgag
tcgtacgcgaagacgtccgggtcgaaggggctgcatctgctggcggcgctggagccgacg
ccgtccgggcgggcgacggagtacgccaaggagctggccgtggcggcggagaaggacatg
ccccgtctcgtcctgcaccgcatgacgcggagcctgcgccccggcaaggtgttcgtcgac
tggagtcagaacgcggcgcggaagaccacggcggccccgtacaccctcagggcccgtgcc
gagcccaccgtctccactcccgtgacctgggaggaggtcgccgactgcactgccgcacgc
ccgctcgccttccaggcccccgacatcgccccccgcctccaggagcacggcgacctgctg
gcccccctgctcgaccccggccacgccgcgcccctgccgtga

DBGET integrated database retrieval system