KEGG   Streptomyces avermitilis: SAVERM_2988Help
Entry
SAVERM_2988       CDS       T00126                                 

Gene name
sodN
Definition
(GenBank) putative superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sma  Streptomyces avermitilis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAVERM_2988 (sodN)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SAVERM_2988 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: BAC70699
NITE: SAV2988
UniProt: Q82IZ4
LinkDB All DBs
Position
3744146..3744541
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgtttgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggtgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggaa
aagatggccggcaacgacgacccgcacttccaggctcgcgccacggtcatcaaggagcag
cgcgccgagctcgccaagcaccacgtgtcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtccacggacccggccacgggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system