KEGG   Streptomyces avermitilis: SAVERM_3556Help
Entry
SAVERM_3556       CDS       T00126                                 

Definition
(GenBank) putative secreted protein
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH-4 XOO_2897-deam
Motif
Other DBs
NCBI-ProteinID: BAC71268
NITE: SAV3556
UniProt: Q82HF3
LinkDB All DBs
Position
complement(4403425..4406136)
Genome map
AA seq 903 aa AA seqDB search
MGIPDRRNGTSGGASGGTSGGASGGVAGGASGSGVGGTSGGAAAAVSGGASGGVSDARGN
ADAHGASAAPGAHAASAAPGGGTPWPAAGGADDDVQDAAPQDSVPGPPPGATPWAGTDTN
AEAGEDRSVPLPATVFAPPLSGLGDLRDEDTPPPAATPDAKTALMSGGSGLPRTTVAPAL
DDAVPAAPQGPVTPPPGPGAPRVPSGPSAAQGPGAPEGAAPSAPSYGYPQGPGAAPSAPS
YGYPQGPGAVPGTPPPGAPQAPGAPHAPGAPQAPTGSPVPGRPLAPNAGDIADAATSKAA
PPRGARAGAPRPPGAPGVPGAPGTPGAPGAMPPASGPGAPGTPAGGYVPTQLVSQLGPDG
PEGLAGPNPPSAPGTPNPPGGTPPGGVHHAATMFADPGRPGAGPGAPQPPGPPGAPGRPG
VPNPPGPPGAPGQPGAPGAPGAPNTPGGTPPGGVHHAATMLAGPSVGGPGAPLPPPGAPG
APGMPPGAPGAPGAPGGPGGVHHAETMLAGPPVGGPGLPPPGAPGAPGMPAGTPPGVPQG
WPPPQPGQAMAPQPMPGQPMPPQPMPGQQPPAYGYPPTGQPTVGPGYQAVLRYRAQDGSE
QQLIRRSAPGTPHPEWQILHELRAMNVPPQQVLELHTELESCELPGAYCARMIRESWPQA
RITSIATYGTDHASRQQGMQELLAHQGELHQVADGPARPGPVRSPLPPVPPAQPIPPEAI
AQELAAAFGPGVFHFDQAAVSRQGVPPIVAHTLVVAGLPVDMGPFFWAQAQPGRPVPTLA
ELAQERGVQPGPDAGSYLVMGSDFGKAICVQYGTANIVAVPVEAGPGGAPVSPQFVNTGL
PEFARCLALLGRMWRLRFGLNQEQAGRWTVDFQAQLASLDPAALGSPESWWSVLLEQMWD
GLL
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggggattccggaccggcggaacggtacgtcgggcggtgcgtccgggggtacctcgggc
ggtgcgtccggcggtgtggccggtggcgcgtcgggttccggggtcggtggtacgtccggt
ggggcggccgccgcggtgtccggtggggcgtccggtggggtttcggatgcgcgcgggaac
gcggacgcgcacggtgcgtcggccgcgccgggggcgcacgccgcgtcggcggctcccggc
gggggtacgccgtggcccgcggccggtggtgcggacgacgacgtacaggacgcggcgccg
caggacagcgttccgggtccgcctccgggggcgaccccgtgggccgggaccgacaccaac
gcggaggcgggcgaggaccgttcggtgccgttgcccgcgaccgtgttcgcgccgccgctg
agcggcctcggcgacctgagggacgaggacactccgccgccggccgcgacgccggacgcc
aagacggcgctgatgtcgggcggcagcgggcttccgcgtacgacggtggcgccggccctc
gacgacgcggtgcccgctgctccgcagggccccgtcacgccgcccccgggccccggtgct
ccgcgggttccctccgggccgtcggcggcccagggtcccggtgcgccggagggtgcggcc
ccgagtgcgccttcgtacggctatccgcagggtcccggcgcggccccgagtgcgccttcg
tacggctatccgcaaggtcccggcgcggttccggggacgccgccgcccggtgccccgcag
gctcccggtgctccgcacgctccgggtgctccgcaggctccgacgggttcgcccgttccg
gggcggccgctcgcgccgaacgccggtgacatcgccgacgccgcgaccagcaaggcggcg
ccgcctcggggtgcgcgcgcgggtgcgccgcgtccgccgggcgcgccgggggttccgggt
gcgcctggaacgccgggtgcgcccggtgccatgcctccggcgtccgggcccggtgctccg
ggtacgcccgcgggcgggtacgtgccgacgcagctcgtctcgcaactgggtccggacggg
cccgagggcctcgcgggcccgaatccgccgagcgcgcccggtacgccgaaccctccgggc
ggtacgccgcccgggggtgtccatcacgcggccacgatgttcgccgacccgggccggccc
ggtgccggccccggcgcgccccagccccccggtccgcccggcgctccgggccgtccgggc
gtcccgaaccctccgggcccgcccggtgctcccggtcagccgggtgctcccggcgcgccc
ggtgccccgaacactccgggcggtacgcctcccggtggcgtccatcacgcggccaccatg
ctcgccggtccctcggtgggcggcccgggcgcgccgcttccgccgccgggtgcccccggt
gccccgggcatgcctccgggcgcacccggtgctcctggagcccccggtggccccggtggt
gtgcaccacgccgagacgatgctggccggtcccccggtcggcggtcccggtctgcccccg
ccgggtgctcccggtgctccgggcatgcctgccggtacgcctccgggtgtgccgcagggc
tggccgccgccccagccgggacaggccatggcgccgcagccgatgcccggtcagccgatg
ccgccgcagccgatgcccggtcagcagcccccggcgtacggctatccgccaaccggtcag
ccgaccgtcggtcccggctaccaggccgtgctgcgctaccgcgcccaggacggttccgag
cagcagctcatccggcgttcggcgccgggcaccccgcacccggagtggcagatcctgcac
gagctgcgcgccatgaacgtgccgccgcagcaggtgctggagctgcacacggagttggag
tcgtgcgagctgccgggtgcgtactgtgcgcggatgatccgggagagctggccgcaggcg
cggatcaccagcatcgccacgtacggcacggatcacgcgagccgtcagcagggcatgcag
gaactcctcgcgcaccagggcgagttgcatcaggtggcggacggtccggcgcggccgggt
ccggtgcggtcgccgctgccgccggtgccgccggcgcagccgatcccgccggaggcgatc
gcgcaggagctggcggccgccttcggtcccggtgtcttccacttcgaccaggccgcggtg
tcccggcagggggtgccgccgatcgtggcgcacaccctggtggtggccggtctgccggtc
gacatgggcccgttcttctgggcgcaggcccagccgggccgtccggtgccgaccctggcg
gagctggcgcaggagcgcggggtgcagccgggcccggacgcgggttcgtacctcgtgatg
ggaagcgacttcggcaaggcgatctgcgtccagtacggcacggcgaacatcgtcgccgtg
ccggtggaggcggggccgggcggtgcgcccgtatcgccgcagttcgtgaacacggggctg
cccgagttcgcgcgctgtctcgcactgctgggccggatgtggcgcctgcggttcggtctc
aaccaggagcaggcgggccgctggacggtcgacttccaggcgcagctcgcctccctcgat
ccggcggcgctcggctctccggagagctggtggtcggtgctgctggagcagatgtgggac
gggttgttgtag

DBGET integrated database retrieval system